PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g088035.1
Common NameMTR_4g088035
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 269aa    MW: 30120.1 Da    PI: 7.9871
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g088035.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26099.33.9e-3161051100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCa C+++++kC kdC+lapy+p ++++++  vhk+FG +++ k+l++l+e+ r++a++s  +eA+++ +dP++G +g +++ q+++++l++ l
  Medtr4g088035.1   6 ACAPCRHQKKKCMKDCFLAPYYPTKKKQEYDLVHKVFGYKKLEKMLRNLDEQGRKKAIESFDWEAKMWKQDPINGPLGAFTEAQNEIARLQNLL 99 
                      7******************************************************************************************999 PP

           DUF260  95 allkee 100
                      ++++++
  Medtr4g088035.1 100 QQQQDQ 105
                      988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089120.7985106IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-286102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MINKTACAPC RHQKKKCMKD CFLAPYYPTK KKQEYDLVHK VFGYKKLEKM LRNLDEQGRK  60
KAIESFDWEA KMWKQDPING PLGAFTEAQN EIARLQNLLQ QQQDQTVPSS DPKFMGLAQN  120
SFSYNSDAVP VSSNGNWSSF EAPFVANNNV VHNPYFEYPY GGNSFGSIGA LQNEETNLLN  180
CVVAGPNVWQ PSQPNYLQSL ASSSGTKVTV DHNIITNQHM GMQGEGQQHS KYYSFGNCKE  240
FFSLLLSLVG IDICAPFSLA SFLLNIKC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-18710512110LOB family transfactor Ramosa2.1
5ly0_B8e-18710512110LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00128DAPTransfer from AT1G06280Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g088035.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456911.10.0LOB domain-containing protein 2
TrEMBLA0A072UMQ10.0A0A072UMQ1_MEDTR; LOB domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF147861315
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.13e-23LOB domain-containing protein 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]