PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g086835.1
Common NameMTR_4g086835
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 418aa    MW: 46524.9 Da    PI: 8.489
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g086835.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32274329156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W+peLH+rFv+a+++LGGs+ AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Medtr4g086835.1 274 KQRRCWSPELHRRFVNALQKLGGSQAATPKQIRELMQVDGLTNDEVKSHLQKYRLH 329
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-29271332IPR009057Homeodomain-like
SuperFamilySSF466893.14E-18271332IPR009057Homeodomain-like
PROSITE profilePS5129414.664271331IPR017930Myb domain
TIGRFAMsTIGR015572.4E-27274329IPR006447Myb domain, plants
PfamPF002494.2E-8276327IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MGCVVPAELS LDLRPTFVPK TIANFLFHLS TIQTTSDKLS KLHDFLSRLE DELNKIDAFK  60
RELPLSMLLL NDAILVLKEE LEKCTSKNSV PVLEEFIPLK KEIDQSEENK NNDRDKNNNN  120
ECSKDKKNWM SSVQLWNNNT TTSNNNVSDH HHHHKLNKLE TTKKREEGQS VTVAEDLFQS  180
CSSNRNGGSA FMPFSAYSSV PVTTVTLSAP KEEKEEPVRN RLSFLTPEVK SLREGFGSRG  240
SRSSSNRAVS SSSPPTVQPS LRAAPLQPQQ TSRKQRRCWS PELHRRFVNA LQKLGGSQAA  300
TPKQIRELMQ VDGLTNDEVK SHLQKYRLHT RRVPAASGTD QSVVVLGGLW MPQEHYNDSS  360
KGSSTASGSP QSPLHLATGS RGGTSPTEGD SMEDDDDEKS ESYSWKSHIH RHGKVGV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13274327154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-13274327255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.79400.0leaf| root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g086835.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456887.10.0myb family transcription factor EFM isoform X1
TrEMBLA0A072UPI80.0A0A072UPI8_MEDTR; Myb-like transcription factor family protein
STRINGAES902340.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.13e-46G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]