PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g083680.1
Common NameMTR_4g083680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 175aa    MW: 18952.3 Da    PI: 7.8927
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g083680.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.61.4e-45151141100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca+dC +apyfpa++p+kfanvhk+FGasnv k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++l
  Medtr4g083680.1  15 PCAACKLLRRRCAQDCLFAPYFPADEPHKFANVHKVFGASNVNKMLQDLPEHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQTQL 108
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr4g083680.1 109 AVAQAE 114
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.80414115IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-4515112IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MKESGGNKKQ GAASPCAACK LLRRRCAQDC LFAPYFPADE PHKFANVHKV FGASNVNKML  60
QDLPEHQRGD AVSSMVYEAN ARVRDPVYGC VGAISSLQQQ IDVLQTQLAV AQAEAVHLRV  120
RQTASSFWNS AGHSPTSPTY SGSPSSKINE SQQAKNIFDM DMVVDQAAYG DSMW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-50111147110LOB family transfactor Ramosa2.1
5ly0_B8e-50111147110LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g083680.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607861.11e-129LOB domain-containing protein 4
SwissprotQ9SHE92e-73LBD4_ARATH; LOB domain-containing protein 4
TrEMBLG7JIR81e-128G7JIR8_MEDTR; LOB domain protein
STRINGAES900581e-129(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.12e-75LOB domain-containing protein 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]