PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g063780.1
Common NameMTR_4g063780
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 335aa    MW: 36632.5 Da    PI: 9.7601
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g063780.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1222.1e-3872130361
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      e alkcprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+n+k+
  Medtr4g063780.1  72 EPALKCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRRNNKK 130
                      6789***************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2255124IPR003851Zinc finger, Dof-type
PfamPF027014.4E-3274129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.44175129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009611Biological Processresponse to wounding
GO:0009625Biological Processresponse to insect
GO:0009753Biological Processresponse to jasmonic acid
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MVFSSIQGYV DPPNWHHQQP NHQQANGSDN TQLLPPLPPQ VGGSTTGGGT MGSIRPGSMA  60
DRARLAKLPP PEPALKCPRC DSTNTKFCYF NNYSLTQPRH FCKTCRRYWT RGGALRNVPV  120
GGGCRRNNKK NKRSRSKSPN STNSQEKQTS SSSAIPSHHE LIGHQLPQTI PNLPFMASMQ  180
NLNRYVVGNV NMGLGLREIQ EQQQQQDHMG FQIGIGNGNS TSVSVSASSV AGGVGVEPWR  240
NLQQFPFLNT FESNSSGNNP YTFQGESNIE AAAASGFVRD IASNSRANQE PPVKMEENRA  300
LNFSRTSLGV SEHNNQQQYY SWNDLSGSSS THIL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g063780.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013456108.10.0dof zinc finger protein DOF3.6
TrEMBLA0A072UK580.0A0A072UK58_MEDTR; Dof domain zinc finger protein
STRINGXP_004505871.11e-157(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-28DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]