PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g063735.1
Common NameMTR_4g063735
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WOX
Protein Properties Length: 258aa    MW: 29192.2 Da    PI: 6.8569
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g063735.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.6e-212483357
                     --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                     +R+++tkeq+  Le+l+++  ++psaee++e++++l    +++ ++V++WFqN++a++++
  Medtr4g063735.1 24 SRWNPTKEQISMLENLYKQgIKTPSAEEIQEITARLrvygHIEGKNVFYWFQNHKARQRQ 83
                     8*****************99**************************************97 PP

2Wus_type_Homeobox114.65e-372285265
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
    Medtr4g063735.1 22 SSSRWNPTKEQISMLENLYKQGIKTPSAEEIQEITARLRVYGHIEGKNVFYWFQNHKARQRQKQ 85
                       689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007111.4341984IPR001356Homeobox domain
SMARTSM003899.0E-82188IPR001356Homeobox domain
SuperFamilySSF466893.29E-132391IPR009057Homeodomain-like
PfamPF000466.8E-192483IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.1E-92483IPR009057Homeodomain-like
CDDcd000866.41E-82585No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEGENNNEMN EEGSNGNNSI SSSSRWNPTK EQISMLENLY KQGIKTPSAE EIQEITARLR  60
VYGHIEGKNV FYWFQNHKAR QRQKQKQESI AYFNRLLHRP QPIYPSPICP NAMRAPYCVP  120
QPQSHEISYY PQNPKVLLPA VGYRRNHAEK VMSNSNGMSN ICNSPMVYNE NMQQRILNPN  180
YDFGYSNQET LDLFPLHPTG ILEGKSTDQV SSIVSVSADS STDTHSGSSH HEINQDHGYN  240
GNKPFFDFFN NSAGQGS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g063735.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027348274.11e-119WUSCHEL-related homeobox 2
TrEMBLA0A072UK530.0A0A072UK53_MEDTR; Putative transcription factor Homobox-WOX family
STRINGXP_004505911.11e-107(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.13e-47WUSCHEL related homeobox 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]