PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g032260.1
Common NameMTR_4g032260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 161aa    MW: 18505.6 Da    PI: 9.2213
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g032260.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF46.16.4e-151050242
                     ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
           SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                     +i n+  r+  + kR++ ++KK  ELS+LC++e++ i++++
  Medtr4g032260.1 10 FIVNDAARKAAYKKRKKSLFKKVVELSTLCGIEACAIVYGP 50
                     7899***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.89149IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-16160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.63E-22394IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-5323IPR002100Transcription factor, MADS-box
PfamPF003194.4E-141050IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-52338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MVRTKVKLAF IVNDAARKAA YKKRKKSLFK KVVELSTLCG IEACAIVYGP YEPHPEIWPS  60
PEGVQSVLSK FMTMHEFQKC NKKMDHETFM THRVLKAEEK LMKQRKDNRE QEMTLLMTQC  120
LNEGKVVHDN LPTDDLSDLS WLIDHNLKDI GRRLESSSLA *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2035550.0AC203555.16 Medicago truncatula clone mth2-58e9, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003605492.11e-118MADS-box transcription factor family protein
SwissprotQ9FJK31e-46AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLG7JN521e-118G7JN52_MEDTR; MADS-box transcription factor family protein
STRINGPOPTR_0005s00420.14e-64(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.11e-43AGAMOUS-like 80
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]