PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g022370.1
Common NameMTR_4g022370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 365aa    MW: 39343.3 Da    PI: 9.609
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g022370.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.61.3e-3879138362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      e+alkcprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalrnvPvGgg r+nk+ss
  Medtr4g022370.1  79 ETALKCPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRNVPVGGGFRRNKRSS 138
                      7789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3062127IPR003851Zinc finger, Dof-type
PfamPF027011.7E-3281136IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.24582136IPR003851Zinc finger, Dof-type
PROSITE patternPS01361084120IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MVFTSIPAAY LDAANWQQQQ QNHHQQPGNG GSVSQQLLQT QTPPPQQSQS QPHGGGSTGS  60
IRPGSMSDRA RMANMPMPET ALKCPRCEST NTKFCYFNNY SLSQPRHFCK TCRRYWTRGG  120
ALRNVPVGGG FRRNKRSSKS SNNGNSTKSP ASSDRQTGSA SSTNSITSNN NIHSSADILG  180
LTPQMSSLRF MTPLHHNFSN PNDFVGGGDL GLNYGFSYMG GVGDLGSALG GNSILSSSGL  240
EQWRMPMSMT HQQHQFPFLA NLEGTNSNLY PFEGNVQNHE MITSGGYVRP KVISTSGIMT  300
QLASVKMEDS INRGFLGINT SNNNSNQGSE QFWNSAVVTG NSAANWTDHV SGFSSSSNTT  360
SNQM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAPTransfer from AT5G02460Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g022370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1260190.0AC126019.16 Medicago truncatula clone mth2-22p22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003604971.20.0dof zinc finger protein DOF2.4
TrEMBLG7JUJ40.0G7JUJ4_MEDTR; Dof domain zinc finger protein
STRINGAES871680.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.16e-39Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]