PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g019670.1
Common NameMTR_4g019670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 520aa    MW: 57059.3 Da    PI: 4.658
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g019670.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.56.2e-121255144
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                     k ienk++r+  + +R++g++ K e + +LC++e++ i+f++++
  Medtr4g019670.1 12 KLIENKTRRKACYKRRLKGLFTKIEHMTILCGIEACAIVFGPSD 55
                     569**************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.007454IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-8463IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-16697IPR002100Transcription factor, MADS-box
CDDcd002662.29E-21688No hitNo description
PfamPF003197.3E-121455IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MTRIRKKKII SKLIENKTRR KACYKRRLKG LFTKIEHMTI LCGIEACAIV FGPSDTKPSI  60
WPSPTVAEEL ITKFESLSLD VQSKNKTDQL TFLKDKGKKL EASLEKINKE NEETLMGAYM  120
HQIENEGKSL DDFDHDVQNR LIAFTLEKIK ITRKITRHLE KEILPLNNPP PPLAPISFTL  180
DNGDGVDYGV NMYGHVLNQQ PLSDLVEKVD QMSSGFNNNP GSSMGIPPLA DLSGGACDKL  240
ANQADFVGFD NGMGISSPEY SSSGFDTTFF QDDFEDFDSI MKIPSHENHS GNVHDMFLPR  300
GNLGHFINNI GTNIGKQSHE NPSGGVGMLP PQGYFGGQSN FQGFDDITGS TSGILPHANL  360
NGNVDSLPPQ ENFEGEENFG GFDNTGSGMW IPHSNSSGGD ALLPQENFGG QFNFEDFDNN  420
TCSNMLIPPH TNPDVGDVDV LSHRGNFGVQ ENFGGFDDNT CSNMWKPPHE NPSNSGVDMM  480
TLHQNNFGGN INGDGMWSFN ANIVDNNYGS NFNPGFPSE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1428RKKKIISKLIENKTRRKACYKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013454922.10.0MADS-box transcription factor family protein
TrEMBLA0A072USW10.0A0A072USW1_MEDTR; MADS-box transcription factor family protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-18AGAMOUS-like 38
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]