PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g015680.1
Common NameMTR_4g015680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Trihelix
Protein Properties Length: 280aa    MW: 33950.1 Da    PI: 7.0239
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g015680.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.21.2e-2441123186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      +W+ qe+ + + +r e+++++ ++k++k+lWe +s++m+e+g++rs++qCk+kw+nl +ryk ++++e +    + +++p++++l+
  Medtr4g015680.1  41 QWSIQETNEFLLIRAELDQTFMETKRNKQLWEVISNHMKEKGYHRSAEQCKCKWKNLVTRYKGCETMETEV--LK-QQFPFYNELQ 123
                      7********************************************************************96..34.479****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122033.43E-2140105No hitNo description
PfamPF138375.8E-2041124No hitNo description
PROSITE profilePS500907.3524298IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MEGHQFHHKN QRQHQQQQQN LHLHNINNTI NVVDVSDRFP QWSIQETNEF LLIRAELDQT  60
FMETKRNKQL WEVISNHMKE KGYHRSAEQC KCKWKNLVTR YKGCETMETE VLKQQFPFYN  120
ELQTIFTARM QRMLWTEAED GSKKKATHLS TDDDEDDGNE ESEAVSQKGS NRKKKKAKVE  180
NESGSSKSFF RNLKEILDEF MRQQLQIEAQ WMEAFEAREN ERRLREMEWR QQMEMLENER  240
ILMEQRWRER EEQRRIREEA RAEKRDALIT ALLNKLERQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003604663.10.0trihelix transcription factor GT-3a-like protein
SwissprotO804503e-73TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLG7JN340.0G7JN34_MEDTR; Trihelix transcription factor GT-3a-like protein
STRINGGLYMA03G07590.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-67Trihelix family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]