PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g452660.1
Common NameMTR_3g452660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 292aa    MW: 31517.1 Da    PI: 5.8323
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g452660.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.53.6e-4171061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC+++C +apyf  e+p++fanvh++FGasnv kllk+l+ ++reda++sl+yeAe r++dPvyG+vg+i+ lqq+l+++++el
  Medtr3g452660.1   7 PCAACKFLRRKCTQECDFAPYFLPENPQRFANVHRVFGASNVAKLLKELDVKDREDAVKSLAYEAESRIKDPVYGCVGLISYLQQKLRETQNEL 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                       ++k+e
  Medtr3g452660.1 101 TVAKKE 106
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.0296107IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-417104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECDFAPYFLP ENPQRFANVH RVFGASNVAK LLKELDVKDR  60
EDAVKSLAYE AESRIKDPVY GCVGLISYLQ QKLRETQNEL TVAKKELAGY NLNPQTMQCL  120
LMNSGTVLMP QQQQQQQQQW NSQFAAFANY PNNFPQEMVG GGGLVMQQQQ EHELQMGGGY  180
QVTPQEYLLR SGGGYQMGGG LQMGAGAGGV AVSDHADVAH PLDMGNFDNG ASGGAGGGVY  240
YQIPQQGGEQ QHNYHVGVAH ANPVEAQLLL SPQNQEAGED GKSVGSAHRS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-4541108114LOB family transfactor Ramosa2.1
5ly0_B2e-4541108114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g452660.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459745.10.0protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A072UWH30.0A0A072UWH3_MEDTR; LOB domain protein
STRINGXP_004500020.12e-98(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2412233
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-53ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]