PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g450310.1
Common NameMTR_3g450310
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 212aa    MW: 24262.2 Da    PI: 8.6165
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g450310.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.12.3e-291973155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     +prlrWtpeLH+ Fv+ ve+LGG++kA Pk+il++m+vkgL ++h+kSHLQ+YR 
  Medtr3g450310.1 19 QPRLRWTPELHQYFVQTVESLGGKDKASPKHILNMMQVKGLRISHIKSHLQMYRN 73
                     59****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.8671676IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-271673IPR009057Homeodomain-like
SuperFamilySSF466899.5E-141873IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-222073IPR006447Myb domain, plants
PfamPF002498.1E-82172IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MKNNNSKRSG VRKYHKSEQP RLRWTPELHQ YFVQTVESLG GKDKASPKHI LNMMQVKGLR  60
ISHIKSHLQM YRNVKGQTIL APTLEENAKF NHLPMCSSCS PQRSRNINQE LQPLHNKRLS  120
QASETDHYYD LNQEPESSAC FLSDISNEEN DCRTTKYLNL PFPFSSLIIP MVHSDQGITH  180
FSSPNETNNH DVDSSSIKSH GRDYINLDLS I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-181975258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g450310.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1484960.0BT148496.1 Medicago truncatula clone JCVI-FLMt-14F11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553155.24e-86putative Myb family transcription factor At1g14600
TrEMBLA0A072UUY91e-156A0A072UUY9_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGGLYMA18G14071.12e-85(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF91862839
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.15e-26G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]