PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g435480.1
Common NameMTR_3g435480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 466aa    MW: 51589.9 Da    PI: 5.1001
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g435480.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.5e-39132192262
           zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      ++k l cprC+s++tkfCyynny+++qPryfCkaC+ryWt+GG++rnvPvG+grrknk++s
  Medtr3g435480.1 132 PDKLLLCPRCNSADTKFCYYNNYNVNQPRYFCKACQRYWTAGGTMRNVPVGAGRRKNKNNS 192
                      688899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-28118189IPR003851Zinc finger, Dof-type
PfamPF027011.1E-31134190IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.267136190IPR003851Zinc finger, Dof-type
PROSITE patternPS013610138174IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 466 aa     Download sequence    Send to blast
MIETKDPEIK LFGKKILFPG EGEALMIDGE ENVSPAAAMD VEEERDSESE NEDDEEETEK  60
DPEADKDTEE KKEADPPPDA AEIKNNNNSA ATLPEGNPKT PSIDEETSKS ENEQSETTAN  120
NNDTQEKTLK KPDKLLLCPR CNSADTKFCY YNNYNVNQPR YFCKACQRYW TAGGTMRNVP  180
VGAGRRKNKN NSSSHYRHIT ISEALDAARI ISPNGTHHLQ NLKTNGRVLN FGLDHPHIYD  240
SMSNDLNPAE KKVLNDTRNN GDRFSSASSV TVSKSMEESG KNMTQESLPQ KNNGFIPQVP  300
CMTSVPWPYT WSSGAIPSPQ TLCPPGFPMS FYPAPFWNVP WFPPHTPATT PRSSPKSPTL  360
GKHSRDDDNT NDENAKQDSL QTEESPKQRN GCVLVPKTLR IDDPTEAAKS SIWETLGIKN  420
EGLSRGGMTK AFQSKKDGKN HVQTSPMLMA NPAALARSLN FHENS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.330.0leaf| root| stem
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the vasculature of cotyledons and hypocotyls, leaves and roots. {ECO:0000269|PubMed:19619493}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g435480.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. {ECO:0000269|PubMed:19619493}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0529980.0BT052998.1 Medicago truncatula clone MTYFL_FM_FN_FO1G-I-10 unknown mRNA.
GenBankBT1348000.0BT134800.1 Medicago truncatula clone JCVI-FLMt-12H19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013459285.10.0cyclic dof factor 1
SwissprotQ8LFV31e-110CDF3_ARATH; Cyclic dof factor 3
TrEMBLA0A072UVB60.0A0A072UVB6_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGXP_004514828.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-101cycling DOF factor 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Corrales AR, et al.
    Multifaceted role of cycling DOF factor 3 (CDF3) in the regulation of flowering time and abiotic stress responses in Arabidopsis.
    Plant Cell Environ., 2017. 40(5): p. 748-764
    [PMID:28044345]
  5. Renau-Morata B, et al.
    Ectopic Expression of CDF3 Genes in Tomato Enhances Biomass Production and Yield under Salinity Stress Conditions.
    Front Plant Sci, 2017. 8: p. 660
    [PMID:28515731]
  6. Henriques R, et al.
    The antiphasic regulatory module comprising CDF5 and its antisense RNA FLORE links the circadian clock to photoperiodic flowering.
    New Phytol., 2017. 216(3): p. 854-867
    [PMID:28758689]