PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g117380.1
Common NameMTR_3g117380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 316aa    MW: 35031.4 Da    PI: 7.7946
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g117380.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA565.5e-18231264134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      Cs+C++ kTp+WR gp g ktLCnaCG++y++ +
  Medtr3g117380.1 231 CSHCQVQKTPQWRTGPMGAKTLCNACGVRYKSGR 264
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.6E-8129314IPR016679Transcription factor, GATA, plant
SuperFamilySSF577162.04E-14224287No hitNo description
SMARTSM004013.8E-15225279IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.398229261IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.4E-15229262IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.28E-14230287No hitNo description
PfamPF003206.9E-16231264IPR000679Zinc finger, GATA-type
PROSITE patternPS003440231256IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MVAVGDCNSQ NRQKMEFAVA KALKPSLRSE FVFQQTLGEE LFSFTANTVV AGEDFSVDDL  60
LDFSHGGDIL HHDGDEQEKE SSLSPSSQSL SEDNNSNSTG ASFDSSIFST ELLVPDDDVA  120
GLEWVSHFVD DSLPELSLLY PVQIQTNACP KQHETQHGKT LRFSTEKMKI TTKTRTVKNR  180
KPNPRVWAQR PFFPSPSVVF GAPPAKKQKK KPEAQVVGHE AQEEGQLQRR CSHCQVQKTP  240
QWRTGPMGAK TLCNACGVRY KSGRLFSEYR PACSPTFSSE IHSNSHRKVL EMRKRKGMVG  300
PEPGLPTQTQ MVTTC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.86980.0leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1357990.0BT135799.1 Medicago truncatula clone JCVI-FLMt-16M20 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603996.20.0GATA type zinc finger transcription factor family protein
TrEMBLG7J7S10.0G7J7S1_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA06G01110.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-46GATA transcription factor 7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]