PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g106220.1
Common NameMTR_3g106220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 646aa    MW: 70498.1 Da    PI: 6.5103
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g106220.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.6e-28198251155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++Fv av+qL G++kA+Pk+il++m+v+ +t+e+v+SHLQkYRl
  Medtr3g106220.1 198 KPRVVWSVELHRKFVAAVNQL-GIDKAVPKKILDMMNVENITRENVASHLQKYRL 251
                      79*******************.********************************8 PP

2Response_reg75.91.5e-25141221109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ + +l+++l++ +y +v++++++  al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++a+g+ +++ + ++ 
  Medtr3g106220.1  14 VLAVDDDPTCLLVLETLLRRCQY-HVTTTSQAITALTMLRENKdkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSAYGDTKLVMKGISH 105
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+  eel +
  Medtr3g106220.1 106 GACDYLLKPVRLEELKN 122
                      **************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363926.1E-1662643IPR017053Response regulator B-type, plant
SuperFamilySSF521724.41E-3611132IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-4211147No hitNo description
SMARTSM004486.5E-3212124IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.93913128IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.3E-2214122IPR001789Signal transduction response regulator, receiver domain
CDDcd001562.80E-2715128No hitNo description
PROSITE profilePS5129410.81195254IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-29195256IPR009057Homeodomain-like
SuperFamilySSF466897.7E-20196255IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-24198251IPR006447Myb domain, plants
PfamPF002499.8E-7200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MVDSGDRFPI GMRVLAVDDD PTCLLVLETL LRRCQYHVTT TSQAITALTM LRENKDKFDL  60
VISDVHMPDM DGFKLLELVG LEMDLPVIML SAYGDTKLVM KGISHGACDY LLKPVRLEEL  120
KNIWQHVIRK KKSDPKEKNK TSKPDKTTSD SGSGLRSAGA ENSDENGKLT KKRKDQDEDE  180
DEDKENGNDN EDPSAQKKPR VVWSVELHRK FVAAVNQLGI DKAVPKKILD MMNVENITRE  240
NVASHLQKYR LYLKRISCVA NQQASMVAAL GSADQSYLRM GGSGHFHNNA FRSFSPSGII  300
GNLNTPTSLN GHGFSPSGLL QLGQSRNLNN SCNDQLKFQS AITPVNQNIL QGMPMSIGFD  360
HLQNSKGVIS VQNLNTDVKT TFPIPNKFPD QRPSFATSSS HPPSLGISNN GLMLDTHPER  420
KHGGIGIGYG SSSSSVASQH SEFSFSMLDQ GRHGGNWSSD VPISGIQTNS FSSSECFRQT  480
AVPPSDNMAS LPLQAGYSGG SLPDMHSQGM IFTNSPEYIN GNLPFQGWED RNQDATYHSN  540
VTCGSMNSLA PVNGAVVPPG QTATESTLDT KFFNPIQMKH AGFAELTECS SSRQSPANII  600
SQQKFSNNLG SLEYLASSMM GQEQDKMKLL GGDFICDNYS DGVSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-26194257164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.10920.0flower| leaf| root
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g106220.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0196010.0CU019601.8 M.truncatula DNA sequence from clone MTH2-12A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003603312.10.0two-component response regulator ARR12
SwissprotB8AEH11e-137ORR23_ORYSI; Two-component response regulator ORR23
TrEMBLG7J9W30.0G7J9W3_MEDTR; Two-component response regulator
STRINGAES735630.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-125response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]