PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g103590.1
Common NameMTR_3g103590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 305aa    MW: 34378.5 Da    PI: 7.0417
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g103590.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.47e-20144198256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ ++tkeq  +Le+ F+ +++++ ++++eLA+kl+L +rqV vWFqNrRa+ k
  Medtr3g103590.1 144 RKKLRLTKEQSAVLEDTFKDHSTLNPKQKQELASKLNLGTRQVEVWFQNRRARTK 198
                      678899***********************************************98 PP

2HD-ZIP_I/II121.15.7e-39144232189
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                      +kk+rl+keq+++LE++F+ +++L+p++K+ela++L+l +rqv+vWFqnrRARtk kq+E+d+eaLk++y++l+een+rLe+e +eL++
  Medtr3g103590.1 144 RKKLRLTKEQSAVLEDTFKDHSTLNPKQKQELASKLNLGTRQVEVWFQNRRARTKVKQTEVDCEALKHCYETLTEENRRLEEELKELKS 232
                      69*************************************************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.2140200IPR001356Homeobox domain
SuperFamilySSF466891.3E-18141208IPR009057Homeodomain-like
SMARTSM003891.9E-17142204IPR001356Homeobox domain
CDDcd000861.53E-16144201No hitNo description
Gene3DG3DSA:1.10.10.604.7E-18144198IPR009057Homeodomain-like
PfamPF000462.8E-17144198IPR001356Homeobox domain
PROSITE patternPS000270175198IPR017970Homeobox, conserved site
SMARTSM003402.2E-14200242IPR003106Leucine zipper, homeobox-associated
PfamPF021835.2E-10200234IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MRQIFKYSNI LMNTMNFDIS LGLGLGLGLG LGLHEQRHKQ SKKIKEEEEE DPCNKVEPYS  60
LTLGVGSAAD NIDERNIHHQ VATTTKTESD DFIYNLHQRA SNSTSVMSSF SNSSNSIKRE  120
RNEVHEPEKI SFVDVDDVND NPIRKKLRLT KEQSAVLEDT FKDHSTLNPK QKQELASKLN  180
LGTRQVEVWF QNRRARTKVK QTEVDCEALK HCYETLTEEN RRLEEELKEL KSMKTVNNYM  240
QLPVASLTAC PSCKRICTGT GTGTSDENGS SHTTALILCP KAQIHFYANN NNYTFTQSSA  300
TIAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1192200RRARTKVKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g103590.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1335500.0BT133550.1 Medicago truncatula clone JCVI-FLMt-17I12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013461831.10.0homeobox-leucine zipper protein HAT9
SwissprotA2XE763e-52HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL43e-52HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A072V2J80.0A0A072V2J8_MEDTR; Homeobox associated leucine zipper protein
STRINGXP_004501488.14e-96(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.12e-41homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]