PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g096400.1
Common NameMTR_3g096400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NAC
Protein Properties Length: 209aa    MW: 23721.4 Da    PI: 4.0605
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g096400.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM89.46.2e-2871281128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                      lppGf F+Ptdeel+ ++L  k ++   +  ++i+++d   + Pw+L+ k++ ++++e+yfF+k ++++        +t++g W++ g + +++
  Medtr3g096400.1   7 LPPGFVFSPTDEELILHFLYSKKASLISSHPNFIPDLDPSLLVPWELNdKALCGGNDEYYFFAKVKENK-------SSTENGHWEEIGVTVPIF 93 
                      79********************99999888889**************9556666777889998876643.......46899************* PP

              NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      s ++++vg+kk L f+ g+  ++ +t+Wvm+ey++
  Medtr3g096400.1  94 SGTDQKVGMKKYLLFHIGELAQSFETSWVMQEYHI 128
                      *********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-344159IPR003441NAC domain
PROSITE profilePS5100535.2427161IPR003441NAC domain
PfamPF023658.3E-188128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGDTVKLPPG FVFSPTDEEL ILHFLYSKKA SLISSHPNFI PDLDPSLLVP WELNDKALCG  60
GNDEYYFFAK VKENKSSTEN GHWEEIGVTV PIFSGTDQKV GMKKYLLFHI GELAQSFETS  120
WVMQEYHICS TGFDQSTVSY HGDNKVGENW SEWVLCRVYE IDKNMYPQEG VNYCNSDDDD  180
SGTDLSWQDQ VFLSLELEDD MEGITMPQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-22516015164NO APICAL MERISTEM PROTEIN
1ut4_B8e-22516015164NO APICAL MERISTEM PROTEIN
1ut7_A8e-22516015164NO APICAL MERISTEM PROTEIN
1ut7_B8e-22516015164NO APICAL MERISTEM PROTEIN
3swm_A8e-22516018167NAC domain-containing protein 19
3swm_B8e-22516018167NAC domain-containing protein 19
3swm_C8e-22516018167NAC domain-containing protein 19
3swm_D8e-22516018167NAC domain-containing protein 19
3swp_A8e-22516018167NAC domain-containing protein 19
3swp_B8e-22516018167NAC domain-containing protein 19
3swp_C8e-22516018167NAC domain-containing protein 19
3swp_D8e-22516018167NAC domain-containing protein 19
4dul_A8e-22516015164NAC domain-containing protein 19
4dul_B8e-22516015164NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g096400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0120511e-153CU012051.7 M.truncatula DNA sequence from clone MTH2-60M24 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602629.11e-154NAC domain-containing protein 104
TrEMBLG7JBM01e-153G7JBM0_MEDTR; NAC transcription factor-like protein
STRINGAES728801e-154(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17363395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.17e-43xylem NAC domain 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]