PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g094690.1
Common NameMTR_3g094690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 238aa    MW: 26174.8 Da    PI: 8.5836
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g094690.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.38.5e-41471461100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++ e  r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ael
  Medtr3g094690.1  47 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVAECSRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQSLQAEL 140
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +ll+ e
  Medtr3g094690.1 141 NLLRGE 146
                      *99866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.95346147IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-4047143IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKREGD HDVSNSSNQM GRRHMLGPPG TLNTITPCAA CKLLRRRCAQ  60
ECPFSPYFSP HEPQKFASVH KVFGASNVSK MLMEVAECSR ADAANSLVYE ANVRLRDPVY  120
GCMGAISALQ QQVQSLQAEL NLLRGEILKY KLREAANINM NMNMNMNNMI PSSHQLAMLP  180
SNSSVAVSIA APPPPPPPLP PPPISSTTSN SSSSIYFQQR DPNYNTISSD DNISYFG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-43391583122LOB family transfactor Ramosa2.1
5ly0_B7e-43391583122LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g094690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150352e-55AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602464.11e-176LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T59e-82LBD15_ARATH; LOB domain-containing protein 15
TrEMBLG7J9S31e-175G7J9S3_MEDTR; Fission regulator
STRINGAES727151e-175(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.14e-80LOB domain-containing protein 15
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]