PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g092330.1
Common NameMTR_3g092330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GRF
Protein Properties Length: 541aa    MW: 58405.4 Da    PI: 8.087
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g092330.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC69.25.1e-22160203144
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      d+e grC+RtDGKkWRCs++v  ++ +CErH+hrgr rsrk++e
  Medtr3g092330.1 160 DPEAGRCKRTDGKKWRCSKDVALNNRYCERHMHRGRPRSRKPVE 203
                      79***************************************987 PP

2QLQ53.38.2e-19113143232
              QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32 
                      +FT aQ+ +L++Q+++yKyL+a++PvP++Ll
  Medtr3g092330.1 113 PFTSAQWRELERQAMIYKYLMASLPVPSHLL 143
                      9*****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.5E-8112148IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.615113148IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088804.1E-13113143IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.67160204IPR014977WRC domain
PfamPF088799.4E-18161203IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 541 aa     Download sequence    Send to blast
MGEFRVQDKE PKKKTNIVVG SVQSFEGFSN NHHHRSFFHN HDSSSASAAD ADGYGPTTYN  60
MSFGGDSSAL GANAIIDNGG VSLNFQPFHN ISASNTTLKA GGMAASIGIG YPPFTSAQWR  120
ELERQAMIYK YLMASLPVPS HLLSLDGGFN LRLSNRNNTD PEAGRCKRTD GKKWRCSKDV  180
ALNNRYCERH MHRGRPRSRK PVELHTNNNS NSHHQIKKAR CDSNPFSVPD FTVAVPNPTT  240
RKYGSSSHFL ASTPLHPYLQ SSLSLHNSSF EGSNKQPRGL EWMLNGDPIS LGASNSGWNP  300
LMHNNKLGMT NESSYHNNTE SQYLNSFPLY NSSELAQHEK PFPLLLNPLV VPMQTLQSEK  360
PRGFSFIDAW SNTETVENNA NTTTTSNNGS ASVGKLSLSS LDLSMGGSAV SEEMSTIEMN  420
AAGDDDSTKI ALSNWLNSAQ PWLGSTPGGP LAEVLRPSNV TSISDATNSN PSSPLTTTNR  480
VESIGTSGTG MVSSPSGVLH NKTLASFSDS SGNSSPNVAS SRANSEIALL NKFNHISYVN  540
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g092330.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0095400.0CT009540.10 M.truncatula DNA sequence from clone MTH2-39B3 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602338.10.0growth-regulating factor 3 isoform X1
TrEMBLG7J8910.0G7J891_MEDTR; Growth-regulating factor
STRINGAES725890.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.17e-33growth-regulating factor 7
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]