PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g091820.1
Common NameMTR_3g091820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 307aa    MW: 33439.8 Da    PI: 8.668
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g091820.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.11.1e-393999262
           zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                     k++al+cprC+stntkfCyynnyslsqPryfCk+CrryWt+GG+lrnvPvGgg+rknk+s+
  Medtr3g091820.1 39 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRST 99
                     7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-303297IPR003851Zinc finger, Dof-type
PfamPF027016.7E-344097IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2644397IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104581IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MDTAQWAQGN IGLVKQMDGS TSNSKPTPSM LERKARPQKD QALNCPRCNS TNTKFCYYNN  60
YSLSQPRYFC KTCRRYWTEG GSLRNVPVGG GSRKNKRSTS SSSPSISQSQ PPSSITKNII  120
INPDLATTQN NFPQSASQNP KIHQGQDLNL AYPPQTTEDN YNTISKFIEL PYTTDHQDKT  180
TSAMELLKTA SSSRGLNSFM PMTLSESSAM YNSSGFALQD FKLGVNFGLE GFENGYGGLQ  240
GINNQEGSAG GGGGGGARML FPVVEDQLNK QQQQQVPNSG EFEHQQNRTQ GDSTGYWNGM  300
LGGGSW*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.196300.0root| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g091820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU5712410.0CU571241.2 M.truncatula DNA sequence from clone MTH2-56A22 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602283.20.0dof zinc finger protein DOF4.6 isoform X1
TrEMBLG7J7H30.0G7J7H3_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGXP_007136465.11e-123(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.47e-50Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]