PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g090430.1
Common NameMTR_3g090430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 333aa    MW: 37372.9 Da    PI: 4.472
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g090430.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.61.2e-3751105660
           zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       +cprC s+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++
  Medtr3g090430.1  51 PNCPRCASSNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRR 105
                      58***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2940105IPR003851Zinc finger, Dof-type
PfamPF027017.3E-3251105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.66851105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MFQQRHNNIS SSELDQMLHM LSSPNSNIMP FPTTSMDKSN SKWKPHIEIA PNCPRCASSN  60
TKFCYYNNYS LSQPRYFCKG CRRYWTKGGS LRNVPVGGGC RKNRRGKAVR NSQTDRLSAN  120
YGSADDEDHQ QNQNNGSRDI DMAVVFAKFL NQNPNSTHHG DEELEIESEV NNNGLSSSSN  180
NINNLSSTPE SVETENDAVV QPHKPFDEVQ NYGGEHELSL SGIEYDQFEG FLGVDEDVVQ  240
DVLWPDSNAM NMMMSSSSNN YTWQQPPPMM QMELPGELEL EYSMPLPLPL NNENGTINSN  300
STTSVNLISE SWNSWDSFDL STMEVFSSSS RP*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g090430.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602157.10.0dof zinc finger protein DOF1.2
TrEMBLG7J6640.0G7J664_MEDTR; Dof domain zinc finger protein
STRINGAES724080.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.13e-44Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]