PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g077240.1
Common NameELP1, MTR_3g077240
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 193aa    MW: 20821.4 Da    PI: 7.8578
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g077240.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.6e-4510108199
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+k+l++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el
  Medtr3g077240.1  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKILNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKEL 103
                      7********************************************************************************************* PP

           DUF260  95 allke 99 
                      +++++
  Medtr3g077240.1 104 DSANA 108
                      99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.7869110IPR004883Lateral organ boundaries, LOB
PfamPF031954.6E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MASSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFA NVHKIFGASN VTKILNELLP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELDSANADL LRFAYNEISP  120
NSSLPPLPPL VVPASFHQSQ RQFSSRFGNG NVDGNGFYSS FPYAIPWIND TSSEDISGGV  180
GGRGGGVGGG NL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-67911810119LOB family transfactor Ramosa2.1
5ly0_B9e-67911810119LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.258640.0leaf
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}.
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g077240.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1408490.0AC140849.8 Medicago truncatula clone mth2-17f20, complete sequence.
GenBankAC1478770.0AC147877.10 Medicago truncatula clone mth2-9b13, complete sequence.
GenBankCU2341130.0CU234113.3 M.truncatula DNA sequence from clone MTH2-16M17 on chromosome 3, complete sequence.
GenBankJN4125940.0JN412594.2 Medicago truncatula LOB domain protein mRNA, complete cds.
GenBankJQ6531610.0JQ653161.1 Medicago truncatula elongated petiolule 1 (ELP1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601210.21e-140LOB domain-containing protein 25
RefseqXP_024634900.11e-140LOB domain-containing protein 25
RefseqXP_024634901.11e-140LOB domain-containing protein 25
RefseqXP_024634902.11e-140LOB domain-containing protein 25
RefseqXP_024634903.11e-140LOB domain-containing protein 25
RefseqXP_024634904.11e-140LOB domain-containing protein 25
SwissprotQ9FML44e-72LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLH2D4391e-139H2D439_MEDTR; Elongated petiolule 1
STRINGAES714611e-136(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.41e-74LBD family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Chen J, et al.
    Conserved genetic determinant of motor organ identity in Medicago truncatula and related legumes.
    Proc. Natl. Acad. Sci. U.S.A., 2012. 109(29): p. 11723-8
    [PMID:22689967]
  3. Zhou C, et al.
    Identification and characterization of petiolule-like pulvinus mutants with abolished nyctinastic leaf movement in the model legume Medicago truncatula.
    New Phytol., 2012. 196(1): p. 92-100
    [PMID:22891817]
  4. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  5. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]