PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g073690.1
Common NameMTR_3g073690
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 203aa    MW: 22606.7 Da    PI: 8.7954
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g073690.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.47e-4591081100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk++rrkC+k+C++apyfp e+p+kf +vhk+FGasnv kll++++ ++reda++sl+yeAear+rdPvyG+vg+i++lq++l++l++el
  Medtr3g073690.1   9 PCAACKIQRRKCTKECIFAPYFPPENPQKFTYVHKVFGASNVAKLLNEVDASQREDAVKSLAYEAEARLRDPVYGCVGLISHLQNKLKNLQNEL 102
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      +++k+e
  Medtr3g073690.1 103 NVAKKE 108
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.5128109IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-449106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MMSSCNSSPC AACKIQRRKC TKECIFAPYF PPENPQKFTY VHKVFGASNV AKLLNEVDAS  60
QREDAVKSLA YEAEARLRDP VYGCVGLISH LQNKLKNLQN ELNVAKKELA TYVGPQIMLP  120
TPMTAVSSSY FSVTSSSVHQ QRQEFFTFNA ENSFSNNFQM NPFQNQLMVS SSQAQSSQPI  180
NPFLSKKVFK AERDNLGEGN LI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-4971289131LOB family transfactor Ramosa2.1
5ly0_B8e-4971289131LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in trichomes, at the base of many lateral organs, including branching points of the inflorescence and floral organs and in the distal part of the pistil at stages when style and stigma start to develop. Also detected in pedicels and at the base of petals and sepals. {ECO:0000269|PubMed:15821980}.
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g073690.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024634719.11e-145LOB domain-containing protein 11
SwissprotQ9FKZ32e-60LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A072UZB61e-147A0A072UZB6_MEDTR; LOB domain protein
STRINGXP_004515644.17e-79(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-56ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  3. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]