PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g071590.1
Common NameMTR_3g071590
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 160aa    MW: 17933.6 Da    PI: 7.8388
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g071590.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260140.55.5e-4481071100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+CakdC++apyfp+++pkkfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar++dPvyG+vg i+ lq+q+++l+ +l
  Medtr3g071590.1   8 PCASCKLLRRRCAKDCIFAPYFPSHDPKKFAIVHKVFGASNVSKMLQELPIQQRADAVSSLVYEANARVKDPVYGCVGAISYLQNQVSELQMQL 101
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr3g071590.1 102 AVAQAE 107
                      *99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7197108IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-438105IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MGGNTTSPCA SCKLLRRRCA KDCIFAPYFP SHDPKKFAIV HKVFGASNVS KMLQELPIQQ  60
RADAVSSLVY EANARVKDPV YGCVGAISYL QNQVSELQMQ LAVAQAEILC IQMKHDDQPL  120
MQNQEIALDH KPYDLPQYFN FPSSSNVIHH DSFSRERIF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR3786621e-179CR378662.1 M.truncatula DNA sequence from clone MTH2-41N19 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600972.11e-117lateral organ boundaries (LOB) domain protein
SwissprotQ8LBW31e-72LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7J2B81e-117G7J2B8_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGPOPTR_0008s07280.18e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-74LBD family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]