PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g070120.1
Common NameMTR_3g070120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GeBP
Protein Properties Length: 378aa    MW: 42083.7 Da    PI: 5.0475
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g070120.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573100.81.2e-31152244297
           DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                       fqr+++e+De+++LqGl+df+ak g +p+++++afy++vkks++fkv+ +ql +K+rrL+ K+++k k    +k p+fsk+ ++ +felskki
  Medtr3g070120.1 152 SFQRVFTEDDEVAILQGLVDFTAKSGNDPTKHLSAFYQIVKKSVHFKVTLDQLRDKVRRLRLKYENKIKS---KKTPTFSKPVEETMFELSKKI 242
                      69***************************************************************99988...999****************** PP

           DUF573  96 Wg 97 
                      Wg
  Medtr3g070120.1 243 WG 244
                      *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-29153244IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0005829Cellular Componentcytosol
GO:0009507Cellular Componentchloroplast
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MAKKNSATAA VKDDPPPQED KIEQHDENDE ETSSEAGSSS EGGEEEEESS EEEAPKTTPP  60
PKTNPKNNSV EDEDEEETDT DEDEPPPKTK PIEQTLKSGT KPSIAPARSG TKRPAENNDT  120
KQSNKKKTTE EKNKKKEKEP EEDDNSNNKK ASFQRVFTED DEVAILQGLV DFTAKSGNDP  180
TKHLSAFYQI VKKSVHFKVT LDQLRDKVRR LRLKYENKIK SKKTPTFSKP VEETMFELSK  240
KIWGGGKVDV NEGEENEKVN GKPAKKELAV KKAAAARTTK KLVMEPDSPL VVLKVDSGNG  300
KEDTGLSLVS NETIHFEPVI DVVKRGVESI EESKRGELER LMNKYKIAEM ELFMQKTELA  360
KETATKIRDA LNSSSSH*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.22530.0root| seed| stem
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g070120.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT9610560.0CT961056.6 M.truncatula DNA sequence from clone MTH2-16N8 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600855.10.0GLABROUS1 enhancer-binding protein-like
TrEMBLG7JAP20.0G7JAP2_MEDTR; DUF573 family protein
STRINGAES711060.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.12e-21DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]