PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g064840.1
Common NameMTR_3g064840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 463aa    MW: 50862.1 Da    PI: 7.7019
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g064840.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.74.6e-32275328255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Medtr3g064840.1 275 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 328
                      9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15272328IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28273328IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-23275328IPR006447Myb domain, plants
PfamPF002498.6E-7276327IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MPLEGIFIEP ISTSTTPPDL SLQISPPSTS NSSLICNNTT QTSNYEPHNS SRTTLAQAQA  60
HTELSLGRNF SVSGGAQEQP QQHQQPHNPY YQNQQAHFPH FQHHNSTTTT TSTTTNSSSH  120
MNHINYGVSL LDVSSTSSEG LRPIKGIPVY HNRSFPFLPA MEHSREKDPK MCLYHHMPNS  180
TPSPSSSSSP LSPYIAAGGL DPMSFLNSSG SAAAYRAAVA TRFNNEPFKS HQYPLHHHHH  240
HHSHYGSVGL GSSEASMMRS RFLPKLPTKR SMRAPRMRWT STLHARFVHA VELLGGHERA  300
TPKSVLELMD VKDLTLAHVK SHLQMYRTVK TTDKPAASSG LSDGSGEDDV PQIGSNGGIR  360
QFSDQRGLTD RPIQQDMDYS STNTLWSNSS SSREPWPQTS PNDIDGFRPT IFQSQPISGG  420
HQIQECDSNQ LKNNLSGSNL ECKNPSLEFT LGIPDWNGKG QA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16276330458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g064840.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1474720.0AC147472.18 Medicago truncatula clone mth2-24n18, complete sequence.
GenBankCR9403060.0CR940306.3 M.truncatula DNA sequence from clone MTH2-10B11 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003600664.20.0transcription repressor KAN1 isoform X1
TrEMBLG7J8N80.0G7J8N8_MEDTR; Putative transcription factor MYB-HB-like family
STRINGAES709150.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-64G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]