PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g053270.1
Common NameMTR_3g053270, MTR_5g015950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GRAS
Protein Properties Length: 449aa    MW: 50729.9 Da    PI: 6.6862
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g053270.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2913.1e-89334452373
             GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.......sseelaalkl..fse 86 
                      ++lL++cA+a++s++++laq++L+ l+++  +d+d++qRla  f +AL +r +rs+s       +++++++n       +++++++ +l  f +
  Medtr3g053270.1  33 EQLLIHCANAIESNNATLAQQILWVLNNTTPSDDDSNQRLAGSFIRALTTRATRSCSCNIPEAVTRTANSYNyhhnlaiQTHKFSVIELanFID 126
                      79****************************************************8887777777777777775655544444444444489*** PP

             GRAS  87 vsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...........skeeleetgerLakfA 169
                      ++P+++f++ +aN+aIlea++g + +Hi+ +++++++Q p+L++a+a+  e pp +++T+ +++  +              ++ e+g++L +fA
  Medtr3g053270.1 127 LTPWHRFGYTAANSAILEATKGFTVIHIVNLSLTHCMQIPTLIDAIANHHEVPPLIKLTVAVNNCRNkninhipippmLDLSYDELGSKLVNFA 220
                      ***********************************************************9888655568999999987788999********** PP

             GRAS 170 eelgvpfefnvl...vakrledleleeLrvkp......gEalaVnlvlqlhrll...............desvsleserdevLklvkslsPkvv 239
                      ++ +v +ef+++   +++ +++l +e+Lrv+       +Eal++n++++lh+++                +  s +s r+ +L++v+sl P++v
  Medtr3g053270.1 221 KTRNVIMEFKAVsstYSDGFASL-IEHLRVQVqhynksHEALVINCHMMLHYIPdetlftindtnsnmnLNLNSCSSLRSLFLEAVRSLDPTIV 313
                      ***********866534444444.77776665667779****************9******9999966522233333678************** PP

             GRAS 240 vvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplseka 333
                      vvv+++ad++s+s++ r+ +a++y++  fd++++ lpr s++r++ E+e + ++++nv+a eg +r+er e++ kW++r+++a F+ v +se+ 
  Medtr3g053270.1 314 VVVDEDADLTSSSLVSRLKSAFNYFWIPFDTVDTFLPRGSKQRQWCEAE-ICWKVENVIAYEGIQRVERVESKTKWEKRMRNARFQGVCFSEDS 406
                      *************************************************.******************************************** PP

             GRAS 334 akqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                      + ++k++l +++  g+ +++e++ lvl+Wk+++++++SaW
  Medtr3g053270.1 407 VLEVKAMLDEHA-VGWGLKKEDEFLVLTWKGHNVIFASAW 445
                      ************.789************************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.626427IPR005202Transcription factor GRAS
PfamPF035141.1E-8633445IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MNKNQIPVVI SPCSEFPTPN NPLLHFNNAN CMEQLLIHCA NAIESNNATL AQQILWVLNN  60
TTPSDDDSNQ RLAGSFIRAL TTRATRSCSC NIPEAVTRTA NSYNYHHNLA IQTHKFSVIE  120
LANFIDLTPW HRFGYTAANS AILEATKGFT VIHIVNLSLT HCMQIPTLID AIANHHEVPP  180
LIKLTVAVNN CRNKNINHIP IPPMLDLSYD ELGSKLVNFA KTRNVIMEFK AVSSTYSDGF  240
ASLIEHLRVQ VQHYNKSHEA LVINCHMMLH YIPDETLFTI NDTNSNMNLN LNSCSSLRSL  300
FLEAVRSLDP TIVVVVDEDA DLTSSSLVSR LKSAFNYFWI PFDTVDTFLP RGSKQRQWCE  360
AEICWKVENV IAYEGIQRVE RVESKTKWEK RMRNARFQGV CFSEDSVLEV KAMLDEHAVG  420
WGLKKEDEFL VLTWKGHNVI FASAWLPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-451444867475Protein SHORT-ROOT
5b3h_B8e-461444813421Protein SHORT-ROOT
5b3h_E8e-461444813421Protein SHORT-ROOT
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr3g053270.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT5730530.0CT573053.1 Medicago truncatula chromosome 5 clone mte1-8e5, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003611618.10.0scarecrow-like protein 32
RefseqXP_013459850.10.0scarecrow-like protein 32
SwissprotQ9SN221e-168SCL32_ARATH; Scarecrow-like protein 32
TrEMBLG7K3V60.0G7K3V6_MEDTR; GRAS family transcription factor
STRINGAES945760.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-166GRAS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]