PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr3g031660.1
Common NameMTR_3g031660
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 178aa    MW: 19833.4 Da    PI: 5.6576
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr3g031660.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.72e-4371061100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +Ca+Ck+lrr+C+++C++apyfp+++p+kf +vhk+FGasn++k+l++lp ++r++a++slv+eA+ar+rdPvyG+vg i+ lq+q++ql+ +l
  Medtr3g031660.1   7 PCASCKLLRRRCTQECIFAPYFPSDDPRKFSIVHKVFGASNISKMLQELPIHQRSEAVNSLVFEANARVRDPVYGCVGAISYLQSQVSQLQMQL 100
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr3g031660.1 101 AMAQSE 106
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7486107IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-437104IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGSGSSPCAS CKLLRRRCTQ ECIFAPYFPS DDPRKFSIVH KVFGASNISK MLQELPIHQR  60
SEAVNSLVFE ANARVRDPVY GCVGAISYLQ SQVSQLQMQL AMAQSEILCI QMQQESTTVT  120
NSLPTHVDDQ DDKLMILSES SNCYGVLPQY INFPSSSSSS SNVFQDYEPL KRETFWN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU6515810.0CU651581.9 M.truncatula DNA sequence from clone MTH2-66L10 on chromosome 3, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003599327.11e-130lateral organ boundaries (LOB) domain protein
SwissprotQ8LBW36e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7J0R01e-130G7J0R0_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA11G29450.12e-91(Glycine max)
STRINGGLYMA18G06530.12e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-62LBD family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]