PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g461920.1
Common NameMTR_2g461920
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family SBP
Protein Properties Length: 540aa    MW: 59024.1 Da    PI: 6.967
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g461920.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.92.6e-42171246277
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      Cqv gC++dls++k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Medtr2g461920.1 171 CQVYGCNKDLSSCKDYHKRHKVCEVHSKTSKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 246
                      **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.4E-33165232IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.573168245IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.77E-39169249IPR004333Transcription factor, SBP-box
PfamPF031103.0E-31171244IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MESWSFDSRD KGYVSNDTLG SRTKGSILGW DLKTPSSFLP QQNIENDNNN HGFEELGFHG  60
MLGKQLSNVV DDDDDVVVGS KIVTSNSFVM ATPNAFSERE QQHFNSKHSN SIGDTNGSNS  120
LIDLKLGRFG DHRDGIGTPF SKGTTILSSS GSSTPSKRVR SSAIHSQIAY CQVYGCNKDL  180
SSCKDYHKRH KVCEVHSKTS KVIVNGIEQR FCQQCSRFHL LAEFDDGKRS CRKRLAGHNE  240
RRRKPQVGIH SGRAGRLLQS YGDSRFQGTM LTSASFICQD ILPGEVFSSE KCGNSNWWRP  300
IKAEGGTGFR PLSSIPITNA HPQSRTLFPS YNNKQFPFLQ ENGATSATGS IFCENNSQYP  360
PIQGGSNSGS QSLFQDTSLG SEDFNVFETE SAVQGLSGVS DGGCALSLLS SQSQNSSSQS  420
TGIPMPGHLV IPSSHSHYSM SHVSESGVSD RFPSELNHTD GSHLSPILIS NNNEIAHFEL  480
VDGVFQGSDF VNVKDRLSCE DGTTIDLLQL SSQLQRVEHQ RRALQVKREN DSSCSLQIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29166244684squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g461920.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013464103.10.0squamosa promoter-binding-like protein 16
TrEMBLA0A072V9R50.0A0A072V9R5_MEDTR; LIGULELESS 1 protein, putative
STRINGXP_004488431.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-45SBP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]