PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g450070.1
Common NameMTR_2g450070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 689aa    MW: 75518.2 Da    PI: 5.8163
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g450070.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.94.7e-28213266155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+peLH++Fv av+ L G+++A+Pk+ilelm+++g+t+e+v+SHLQkYRl
  Medtr2g450070.1 213 KPRVVWSPELHKKFVGAVNLL-GADRAVPKKILELMNIEGITRENVASHLQKYRL 266
                      79*******************.********************************8 PP

2Response_reg79.41.2e-26241321109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl vdD+p+ +++l+++l++ +y +v++a++g + l++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++++ +++ + +  
  Medtr2g450070.1  24 VLAVDDNPTCLKVLAKLLSECKY-HVTTATNGFDGLKMLRENRknFDLVISDVAMPDMDGFKLLELVGL-EMDLPVIMLSGYSDTSMVFKGVTH 115
                      799********************.***************888888*******************87754.558********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l+Kp+  eel++
  Medtr2g450070.1 116 GACDYLVKPVRLEELRN 132
                      ***************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363925.3E-1521688IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.0E-4321145No hitNo description
SuperFamilySSF521721.14E-3721146IPR011006CheY-like superfamily
SMARTSM004484.9E-3422134IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011044.20723138IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.4E-2424133IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.50E-2925137No hitNo description
PROSITE profilePS512949.774210269IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.5E-28210270IPR009057Homeodomain-like
SuperFamilySSF466891.79E-19211270IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-24213266IPR006447Myb domain, plants
PfamPF002497.4E-8215265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MAVVENQSRD EDGVIDRFPV GMRVLAVDDN PTCLKVLAKL LSECKYHVTT ATNGFDGLKM  60
LRENRKNFDL VISDVAMPDM DGFKLLELVG LEMDLPVIML SGYSDTSMVF KGVTHGACDY  120
LVKPVRLEEL RNIWQHVVRK KKTYSKDVNK ASNEDKVPNI SGGSNQNILE NSVDQNKRLG  180
KRRKEQDEEE KEEEDEESGD GDEDEDDPSS QKKPRVVWSP ELHKKFVGAV NLLGADRAVP  240
KKILELMNIE GITRENVASH LQKYRLYLKK ATPHDTNMVA GLGGGNDSYL RMRGIDGYAD  300
FCTSTRSGRI GSTTLPSYAP SGVFGRLNSP AGLNMRGINS SILIQPVQSH NTNSSWIPAN  360
QSSSLLHGVP TELNQSKLNN SAAGISQLNQ IDSTGFAAAS DFHDSRAINS SNQVSNHHLL  420
LQGNSQQTHN AGSFRNQSSV GSASLGNKNI TIGGSSNLLD YNRCSENWQS QAQLPKFPAS  480
SLPVCKSFNN DQLPLTSVTA YNQSPLIANS SVDFSSGNTI TVALEEARNV PRCQEDGLIG  540
NFIQPSSYAP RQSWAENKPD YSQNTGRPFN PVNSQVCSSR ALTNSASHNI NQSKTVCSNR  600
VDTSFVDQVY GASTSVARYP EAEKFSSDVQ VNSNDAYKLE KMRSQVGYVE GFGTLEDIMG  660
AIVKREQIEM TLMDGEMCYD SYPVGSCI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-23209272164ARR10-B
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g450070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013463823.10.0two-component response regulator ARR12
TrEMBLA0A072V9570.0A0A072V957_MEDTR; Two-component response regulator
STRINGGLYMA15G24770.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-101response regulator 12
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]