PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g100020.1
Common NameMTR_2g100020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 278aa    MW: 31723.1 Da    PI: 5.4415
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g100020.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.43.3e-40191191101
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      aCaaCk++rrkC ++C+lapyfp++++k+f n+hklFG+ ++++++k++p++ r+++mss+++++++ra dPv G++++i++lq+q+e  +ael
  Medtr2g100020.1  19 ACAACKYQRRKCGTSCILAPYFPHDRQKQFLNAHKLFGVGKITNMIKNVPPHLRDHTMSSIIFQSDMRAMDPVGGCYRFIQQLQSQYEFYQAEL 112
                      7********************************************************************************************* PP

           DUF260  95 allkeel 101
                      +l+++++
  Medtr2g100020.1 113 HLTRQQI 119
                      ***9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.04718119IPR004883Lateral organ boundaries, LOB
PfamPF031954.5E-3619116IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MNNNNNNIIS RNGNGTTQAC AACKYQRRKC GTSCILAPYF PHDRQKQFLN AHKLFGVGKI  60
TNMIKNVPPH LRDHTMSSII FQSDMRAMDP VGGCYRFIQQ LQSQYEFYQA ELHLTRQQIS  120
ICKATQSQQH QQQFAAVSNH HYNDMHVINH NNNEDNDAAL NIINHFNQQH FVDDQLNMNM  180
LPQQQLQLQQ QYVVDDVCIN PNYVPLQEDL NSWANNINIP LSPLTLEGNN KEEDGEEDQE  240
RVGDDQGNDQ KPVFDLINEM NSLDTNSSSI DPGHQVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-25151127104LOB family transfactor Ramosa2.1
5ly0_B7e-25151127104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g100020.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1558960.0AC155896.2 Medicago truncatula chromosome 2 clone mth2-85c24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024632954.10.0LOB domain-containing protein 7
TrEMBLG7IUH80.0G7IUH8_MEDTR; LOB domain protein
STRINGAES678500.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41333259
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.18e-42LOB domain-containing protein 22
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]