PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g096740.1
Common NameMTR_2g096740
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 289aa    MW: 31815.2 Da    PI: 9.5532
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g096740.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.91.1e-3859118362
           zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                      e++lkcprC+stntkfCyynny+lsqPr+fCk+CrryWt+GGalrnvPvGgg+r++kk++
  Medtr2g096740.1  59 ETNLKCPRCESTNTKFCYYNNYNLSQPRHFCKTCRRYWTRGGALRNVPVGGGCRRSKKTK 118
                      6789****************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2626113IPR003851Zinc finger, Dof-type
PfamPF027019.3E-3361116IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.70262116IPR003851Zinc finger, Dof-type
PROSITE patternPS01361064100IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MVFSSIPSYL DPLNWQQVHG AGSIIRPGSI PDQAQAQAAH EVHTGQVQTH QAKLPPPSET  60
NLKCPRCEST NTKFCYYNNY NLSQPRHFCK TCRRYWTRGG ALRNVPVGGG CRRSKKTKKS  120
NTSSTPSKSP ISNSNDKDYS TSASAIHSTS TPLGEFLHPT NRPNYMTSLQ NLNRFGVGNM  180
FQIGDYSSTT GGGEGGVVDQ WRFQQFPFMN NGFDSSTSNV SFPFQSEIVE PTTTSRVTTL  240
MPASVKSEHN GGFNLLRSPM NMSENNNHYN NSWNDFHGLA SSSASRLL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.193960.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g096740.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0518370.0BT051837.1 Medicago truncatula clone MTYF5_F6_F7_F81G-N-10 unknown mRNA.
GenBankBT1358550.0BT135855.1 Medicago truncatula clone JCVI-FLMt-11L4 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465383.10.0dof zinc finger protein DOF2.4 isoform X2
TrEMBLA0A072VDB80.0A0A072VDB8_MEDTR; Dof domain zinc finger protein
STRINGXP_004487016.11e-99(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.12e-37DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]