PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g094600.1
Common NameMTR_2g094600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 313aa    MW: 34399.9 Da    PI: 8.831
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g094600.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.21.3e-19218251134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C++C +t+Tp+WR+gp+g+ktLCnaCG++yr+ +
  Medtr2g094600.1 218 CTHCEVTETPQWREGPNGPKTLCNACGVRYRSGR 251
                      *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.3E-16212262IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.42E-15215275No hitNo description
Gene3DG3DSA:3.30.50.106.0E-15216249IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.952216248IPR000679Zinc finger, GATA-type
CDDcd002024.82E-17217264No hitNo description
PROSITE patternPS003440218243IPR000679Zinc finger, GATA-type
PfamPF003201.3E-17218251IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MPEDIPNMKG SWFFDKNFNG LSDETFDDLK FFDFPLEDVD ANTAEEDWSA LGEPCFDVFS  60
VSPAVFCGKI KTENPQLGEG FSAPFNGISP IIKEAARTAG PTYGKTIPNQ NVPFYEKKVV  120
LQYSPVSVFE GSSASSVENS GFDLPVIPVK RARSKRRRPS SLNPVFSISF IASLQALHKK  180
ISASESDLNR VKKQKRMLSG DIETKKSSSQ ESVVQRKCTH CEVTETPQWR EGPNGPKTLC  240
NACGVRYRSG RLYPEYRPAN SPTFVASVHS NSHKKVLEMR GVVIKDGVRV LSKLAPSNVP  300
GNSVGQCYPG SF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.115370.0leaf| root
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00047PBMTransfer from AT1G08000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2076000.0AC207600.4 Medicago truncatula chromosome 2 BAC clone mth2-31i16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597258.10.0GATA type zinc finger transcription factor family protein
TrEMBLG7IRU30.0G7IRU3_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA12G29730.11e-116(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57582849
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08000.26e-46GATA transcription factor 10
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]