PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g084230.3
Common NameMTR_2g084230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 311aa    MW: 35101.1 Da    PI: 9.6354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g084230.3genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.64.2e-3198151255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH +Fv+ave+LGG+e+AtPk +l+lm+v gL ++hvkSHLQ+YR+
  Medtr2g084230.3  98 PRLRWTPDLHLSFVHAVERLGGQERATPKLVLQLMNVRGLRIAHVKSHLQMYRS 151
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.21894154IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-2994152IPR009057Homeodomain-like
SuperFamilySSF466892.69E-1396152IPR009057Homeodomain-like
TIGRFAMsTIGR015578.4E-2298153IPR006447Myb domain, plants
PfamPF002496.1E-899150IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MAEIHIPSKD VKSESSSGIR AKHASLPIRR KRSFFDLNED AVDDGDDHVI VISEGPCGEI  60
SNNEISSQEG NLSSNNNSSE EGKGRGSTVR QYVRSKMPRL RWTPDLHLSF VHAVERLGGQ  120
ERATPKLVLQ LMNVRGLRIA HVKSHLQMYR SKKLDESGQV LSQKNRAMQG RHHIMDMYGR  180
FNVQGHFGVE NNYLHPSSPL LKQSSYNEIK AHDTSRFHES GVFNNNHVIF RSSSVWDKDF  240
SHLFDVKDAI TRNNIAAIRS SQVSQLLPES KSLSRGDDNG AKHFPWSTYS TSINYQRSSE  300
YTMFGSEVIF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1799153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1799153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1799153357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1799153357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.255320.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g084230.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013464832.10.0uncharacterized protein LOC25487436
RefseqXP_024633228.10.0uncharacterized protein LOC25487436
RefseqXP_024633229.10.0uncharacterized protein LOC25487436
TrEMBLA0A072VAU20.0A0A072VAU2_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072VBV50.0A0A072VBV5_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGXP_004487568.11e-133(Cicer arietinum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.14e-37G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]