PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g068760.1
Common NameMTR_2g068760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 160aa    MW: 17724.9 Da    PI: 8.4896
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g068760.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.94.7e-45131121100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+CakdCv+a yfpa++p+kf  vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+++l
  Medtr2g068760.1  13 PCAACKLLRRRCAKDCVFASYFPADEPHKFGSVHKVFGASNVNKMLQELPEHQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQVDELQTQL 106
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr2g068760.1 107 AQAQAE 112
                      *99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.65312113IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MKDGGRKQGT MSPCAACKLL RRRCAKDCVF ASYFPADEPH KFGSVHKVFG ASNVNKMLQE  60
LPEHQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQVD ELQTQLAQAQ AEVVHMKMHQ  120
FSSDHHQPPS NSSPPSENVY QSSRFFSSPN KMGQSLWSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-4891147112LOB family transfactor Ramosa2.1
5ly0_B4e-4891147112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.227460.0pod
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g068760.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0521610.0BT052161.1 Medicago truncatula clone MTYF9_FA_FB_FC1G-F-14 unknown mRNA.
GenBankBT1446060.0BT144606.1 Medicago truncatula clone JCVI-FLMt-10M6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003596142.21e-117LOB domain-containing protein 4
SwissprotQ9SHE93e-62LBD4_ARATH; LOB domain-containing protein 4
TrEMBLG7ITD61e-116G7ITD6_MEDTR; LOB domain protein
STRINGAES663931e-115(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-64LOB domain-containing protein 4
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]