PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g061030.1
Common NameMTR_2g061030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 340aa    MW: 37816.2 Da    PI: 7.7297
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g061030.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.8e-18199253256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++k+q   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Medtr2g061030.1 199 RKKLRLSKDQSAFLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 253
                      678899***********************************************98 PP

2HD-ZIP_I/II127.75e-41199289192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
  Medtr2g061030.1 199 RKKLRLSKDQSAFLEESFKEHHTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLHKELQELR-ALK 289
                      69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046185.1E-661145IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466898.55E-19187256IPR009057Homeodomain-like
PROSITE profilePS5007117.232195255IPR001356Homeobox domain
SMARTSM003894.0E-16197259IPR001356Homeobox domain
CDDcd000861.69E-15199256No hitNo description
PfamPF000461.7E-15199253IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.8E-17204253IPR009057Homeodomain-like
PROSITE patternPS000270230253IPR017970Homeobox, conserved site
SMARTSM003401.4E-24255298IPR003106Leucine zipper, homeobox-associated
PfamPF021835.1E-11255289IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELGLSLGDS SKPLIGLMEK HPHQTSKELG LGFNTTLSIC PIINTTPRDQ LHQQQEEEKT  60
QRDININNNS NRTENPNHVL HQLDLLPQLS FPWNNPSQNG NLLSTEFGGC SRGLDVNVVP  120
PATVVVMADD EIALSSSPNS AASSFQMDLC MYSRGGSGGR SLSGSGGNKR EFSDGEGYDQ  180
RNSSRVSDED DNCGVRNTRK KLRLSKDQSA FLEESFKEHH TLNPKQKLAL AKQLNLRPRQ  240
VEVWFQNRRA RTKLKQTEVD CEYLKRCCET LTEENRRLHK ELQELRALKT SNPFNMQLPA  300
TTLTMCPSCE RVATNSTATS SVTNTSATIN GNNNNKINQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1197203TRKKLRL
2247255RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.51960.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, stems, leaf sheaths and blades and panicles. {ECO:0000269|PubMed:17999151}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g061030.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1181150.0DQ118115.2 Medicago sativa type II homeodomain-leucine zipper protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003595805.10.0homeobox-leucine zipper protein HOX11
SwissprotA2YW032e-84HOX27_ORYSI; Homeobox-leucine zipper protein HOX27
SwissprotQ6YPD02e-84HOX27_ORYSJ; Homeobox-leucine zipper protein HOX27
TrEMBLG7IJ300.0G7IJ30_MEDTR; Homeobox associated leucine zipper protein
STRINGAES660560.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-61homeobox from Arabidopsis thaliana
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]