PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g056000.1
Common NameMTR_2g056000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family NF-YB
Protein Properties Length: 187aa    MW: 20871.6 Da    PI: 4.6875
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g056000.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB77.71.6e-2441125387
            NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 
                      ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +v+se+++ c+re+r+ti+++ +l al+ lGf +y+e++ +  
  Medtr2g056000.1  41 KEDASLPKATMTKIIKEMLPPDVRVARDTQDLLIECCVEFINLVSSESNEVCNREERRTIAPEHVLKALGVLGFGEYIEEVYAAY 125
                      6899***************************************************************************986543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.0E-3838170IPR009072Histone-fold
SuperFamilySSF471133.14E-3442173IPR009072Histone-fold
PfamPF008089.9E-2144109IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MKEGCVARCE YDGAHNKLMT CRINHNNNTK MEPMDIVAKS KEDASLPKAT MTKIIKEMLP  60
PDVRVARDTQ DLLIECCVEF INLVSSESNE VCNREERRTI APEHVLKALG VLGFGEYIEE  120
VYAAYEQHKM ETVQDSIKGA KWSGAAEMTE EQALAEQQRM FAEARARMNG GTITSNQPDA  180
DQSLEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B5e-324216512133Transcription Regulator NC2 beta chain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.137750.0flower| glandular trichome| leaf| root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g056000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182740.0JQ918274.1 Medicago truncatula nuclear trancription factor Y subunit B1 (NF-YB1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024632301.11e-112protein Dr1 homolog
SwissprotP495922e-87NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A072V8R21e-137A0A072V8R2_MEDTR; Nuclear transcription factor Y protein
STRINGXP_004488351.11e-111(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.28e-90nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]