PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g049610.1
Common NameMTR_2g049610, MtrDRAFT_AC158464g6v2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 240aa    MW: 27533.6 Da    PI: 7.5533
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g049610.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF30.25.9e-10958150
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                     k i++   r+ +f +R ng+ KK +E S   ++e+++i++  +g+l +++
  Medtr2g049610.1  9 KHIQDWKARKSSFNQRSNGLAKKVSEFSSKFGVEACLIVYDGDGRLLTWP 58
                     56888899*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006615.867161IPR002100Transcription factor, MADS-box
SMARTSM004327.0E-6160IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.1E-16290IPR002100Transcription factor, MADS-box
CDDcd001201.22E-12258No hitNo description
PRINTSPR004043.1E-5323IPR002100Transcription factor, MADS-box
PfamPF003194.5E-111157IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-52338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-53859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MGRGKLTIKH IQDWKARKSS FNQRSNGLAK KVSEFSSKFG VEACLIVYDG DGRLLTWPQN  60
SIVVQSILKT YELQKIETTP KIFDVKDYFA NKKNKVEGEI SKVHKEIVMK MYPTWHPCFM  120
NMDGEQLKTF IGILDAKIQA CNHKISMLKK MQQRTENGFM LNTTQMQNVA PKNVVSTHLK  180
PLSDTNRLGE VEELDDFMDW ANQVLDNVAY LDDPVTKPGQ EWETQFMDFD ALPETRDGF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1584640.0AC158464.2 Medicago truncatula chromosome 2 clone mth2-145m24, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003595578.10.0MADS-box transcription factor family protein
TrEMBLQ2HRQ10.0Q2HRQ1_MEDTR; MADS-box transcription factor family protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.18e-12M-type_MADS family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]