PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g034960.1
Common NameMTR_2g034960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARR-B
Protein Properties Length: 607aa    MW: 67167.3 Da    PI: 7.6737
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g034960.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like86.72.2e-27211264155
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      kpr++W+ eLH++F+ +v+qL G +kA+Pk+i+e+m+v+gLt+e+v+SHLQkYRl
  Medtr2g034960.1 211 KPRVVWSIELHQQFMAVVNQL-GLDKAVPKKIMEMMNVPGLTRENVASHLQKYRL 264
                      79*******************.********************************8 PP

2Response_reg73.86.8e-25351431109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+p+ +++l+++l+   y ev+ ++ +e al ll+e++  +D++l D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  
  Medtr2g034960.1  35 VLVVDDDPTCLMILERMLRFCLY-EVTKCKRAEVALSLLRENKngFDIVLSDVHMPDMDGFKLLEHIGLEM-DLPVIMMSADDGKNVVMKGVTH 126
                      89*****************9999.***************999999**********************6654.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +e+l +
  Medtr2g034960.1 127 GACDYLIKPVRIEALKN 143
                      *************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.5E-1639593IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.0E-4032176No hitNo description
SuperFamilySSF521724.98E-3532159IPR011006CheY-like superfamily
SMARTSM004484.0E-2933145IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011041.50334149IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.6E-2235143IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.67E-2636148No hitNo description
Gene3DG3DSA:1.10.10.604.1E-29208269IPR009057Homeodomain-like
PROSITE profilePS512949.448208267IPR017930Myb domain
SuperFamilySSF466892.69E-19208268IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-23211264IPR006447Myb domain, plants
PfamPF002492.8E-7213263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MKLNNNNNKI SMSTSTSPSN SGNLVSDQFP AGLRVLVVDD DPTCLMILER MLRFCLYEVT  60
KCKRAEVALS LLRENKNGFD IVLSDVHMPD MDGFKLLEHI GLEMDLPVIM MSADDGKNVV  120
MKGVTHGACD YLIKPVRIEA LKNIWQHVVR KRKNSWKDLR QSGGLDERDR EKKASTDANY  180
SSSTNEGKSS KKRRDEEDEA DDRDDCSTSK KPRVVWSIEL HQQFMAVVNQ LGLDKAVPKK  240
IMEMMNVPGL TRENVASHLQ KYRLYLRRLS GVSQQQSNLN NSFMSAQESI FGGTSVNEID  300
LQTLSASGQF SAQSLAKLQA AGLYSPENSK LRFGDGQLQH MSSSKPVNFL HGIPINIEPK  360
QFANFHQSAQ SFGSANMRVN ASAAKRSPWL TQMAQSQPRG QVLNENTNSH ATMFPSSLMQ  420
PTGPNGISVN SFPLRCTSGI SSSSTKGAFH AEATSGIKGL GGFSYDVYNE LHRKSNDWGL  480
ANTGLTYDGS QHSNTLQGNI DVSPSILGHR GFSSIQQTRQ NRDGMSQGDH QNVGQHLNTP  540
FVDNSLRGKS ERIPGTNIEI NPFSDQSQED LMSVFLNQHK GIGQVDNEFD FDGYSIDNIP  600
VYNRSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-21207270164ARR10-B
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.260700.0root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Detected in the whole plant. Predominantly expressed in pollen. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:15173562, ECO:0000269|PubMed:9891419}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269|PubMed:11370868, ECO:0000269|PubMed:11574878, ECO:0000269|PubMed:15282545, ECO:0000269|PubMed:16407152}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g034960.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1350810.0BT135081.1 Medicago truncatula clone JCVI-FLMt-22G12 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594816.10.0two-component response regulator ARR2
SwissprotQ9ZWJ90.0ARR2_ARATH; Two-component response regulator ARR2
TrEMBLG7IMX20.0G7IMX2_MEDTR; Two-component response regulator
STRINGAES650670.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39583458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-176response regulator 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  3. Ge XM, et al.
    Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis.
    Plant J., 2015. 82(1): p. 138-50
    [PMID:25704455]
  4. Takahashi N,Umeda M
    Cytokinins promote onset of endoreplication by controlling cell cycle machinery.
    Plant Signal Behav, 2014. 9(8): p. e29396
    [PMID:25763620]
  5. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  6. Arnaud D, et al.
    Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis.
    Plant Cell, 2017. 29(3): p. 543-559
    [PMID:28254779]
  7. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  8. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  9. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  10. Takatsuka H,Higaki T,Umeda M
    Actin Reorganization Triggers Rapid Cell Elongation in Roots.
    Plant Physiol., 2018. 178(3): p. 1130-1141
    [PMID:30185441]