PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g027800.1
Common NameMTR_2g027800, MtrDRAFT_AC161399g17v2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 314aa    MW: 34307.1 Da    PI: 7.1017
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g027800.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.81.2e-333993155
          G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Medtr2g027800.1 39 KPRLRWTQDLHERFVDAVTQLGGPSKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 93
                     79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.4E-323694IPR009057Homeodomain-like
PROSITE profilePS5129410.3413696IPR017930Myb domain
SuperFamilySSF466891.27E-163995IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-243994IPR006447Myb domain, plants
PfamPF002491.2E-74192IPR001005SANT/Myb domain
PfamPF143792.2E-15137182IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MFPRLIHPHD GIVVGQDDLQ GGVSNHKGDP CLVLTADPKP RLRWTQDLHE RFVDAVTQLG  60
GPSKATPKAI MRTMNVKGLT LFHLKSHLQK YRLGKQSGKD IGEGCKDGMT GSYLLESPGT  120
ENPSPKLPTS DTNEGYEIKE ALRAQMEVQS KLHLQVEAEK HLQIRQDAER RYMAMLERAC  180
KMLADQFIGA TVIDTDSQKF QGIENKAPRG PLVDHLGFYS LPSTEAAGVN VPEEEVPQTI  240
PPQRADCSTE SCLTSHESSG GLTLEGSQVG GKRRMLGMDS MAAPLIWSEA KMKTQAINLG  300
QGNHPLGISR YGM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-183995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-183995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-183995157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-183995157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.114600.0root| seed| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g027800.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1397930.0BT139793.1 Medicago truncatula clone JCVI-FLMt-13F21 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003594367.10.0protein PHR1-LIKE 2 isoform X1
RefseqXP_024631419.10.0protein PHR1-LIKE 2 isoform X1
TrEMBLA2Q5E60.0A2Q5E6_MEDTR; Homeodomain-related
STRINGAES646180.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.14e-66G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]