PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g016220.2
Common NameMTR_2g016220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 375aa    MW: 43418.3 Da    PI: 7.4356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g016220.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.67.6e-3090143255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtpeLH++F++ave+LGG e+AtPk +l+lm+v gL + hvkSHLQ+YR+
  Medtr2g016220.2  90 PRLRWTPELHHSFLHAVERLGGLERATPKLVLQLMSVRGLNIGHVKSHLQMYRS 143
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-2886144IPR009057Homeodomain-like
PROSITE profilePS5129410.05186146IPR017930Myb domain
SuperFamilySSF466893.76E-1488144IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-2190145IPR006447Myb domain, plants
PfamPF002499.5E-791142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MSEEGHEIHN NYIQSEDLQL VEESDNSSGS SKKWSSFDLN EEATSEDNNH EATLEENENE  60
KENIEGNSRS REGNNERRGK VRHYVRSKMP RLRWTPELHH SFLHAVERLG GLERATPKLV  120
LQLMSVRGLN IGHVKSHLQM YRSKKLDEFG QVLCQTQRST QEVGRSQKLD LSQHFKMGNG  180
GIILSSSYNE QHHNPQYFPT LLKPCPSFSL SRNYSHTNSS HHDDSRHQHW HFNHQPFKFA  240
PVTPTQFLEE KNWSPFEIMN NIHQPEFKRL LSNVTSKTWS KPIEKVEWNN TSSSITNNTE  300
YLLKSKEPCT SSTSLLLQFE APFRIKLNQE KVHKDEKRLL PDLQLGLSHI YGNNDGKIDH  360
CRETKEISTK LSLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-1791145458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g016220.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631505.10.0transcription factor LUX isoform X2
TrEMBLA0A072V3K00.0A0A072V3K0_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
STRINGAES839410.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-32G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]