PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g015000.1
Common NameMTR_2g015000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family WOX
Protein Properties Length: 458aa    MW: 50984.1 Da    PI: 8.0316
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g015000.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.3e-1853113257
                      T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
         Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                      ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  Medtr2g015000.1  53 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 113
                      89*****************99*************************************995 PP

2Wus_type_Homeobox111.54.4e-3652114264
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        +++RW+P+peQi+iLe++++sG+++P++eei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
    Medtr2g015000.1  52 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 114
                        689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-739112IPR009057Homeodomain-like
SuperFamilySSF466895.13E-1249117IPR009057Homeodomain-like
PROSITE profilePS5007110.70649114IPR001356Homeobox domain
SMARTSM003894.8E-951118IPR001356Homeobox domain
CDDcd000868.12E-952114No hitNo description
PfamPF000461.2E-1553113IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009735Biological Processresponse to cytokinin
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0010075Biological Processregulation of meristem growth
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQWQHDINSS LISSACHRTP YSSGCEERSP EPKPRWNPKP  60
EQIRILEAIF NSGMVNPPRE EIRKIRAQLQ EYGQVGDANV FYWFQNRKSR SKHKLRHLQN  120
QNKNQNQNQN QNQDQPPQQN PNSLSQISAT VPSSSSSSSE KSPPKELIPA KVFSLGFPNI  180
NDVVPNSPTA SVNQNQTYFQ TQNVTTLLPP PQVTAPTTET FFFPVQHHGQ GIVLPNNVTS  240
QGFCFSELSN MVPAQSHGQQ HHNTGNCTTS FLLSEIMNNH GVNSSKKDQE QDKSVKIMHQ  300
IPPHLNICLP PATTTTTVLH PTTSSTITVP SPIISQVQGI GEPGVAAKSV VFINDVAFEV  360
ASGPFNVRAA FGDDAVLVHQ TGQPVLTNQY GVTLHSLQHG ALYYLVSTCR KENAGECDEG  420
YYSIEVYRRT LLMRMTSDIC AVLKYGYHHH DFVDLNM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g015000.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1997600.0AC199760.2 Medicago truncatula chromosome 2 BAC clone mth2-104L7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631536.10.0WUSCHEL-related homeobox 9
TrEMBLG7IFI60.0G7IFI6_MEDTR; Putative transcription factor Homobox-WOX family
STRINGAES639370.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.17e-68homeobox-3
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]