PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g013370.1
Common NameMTR_2g013370
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family Dof
Protein Properties Length: 275aa    MW: 30813.2 Da    PI: 8.4729
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g013370.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1122.6e-3544100461
           zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                      +a++cprCdstntkfCyynny+ sqPr+fC+aC+r+WtkGG+lrnvPvGg  rknk++
  Medtr2g013370.1  44 EAVNCPRCDSTNTKFCYYNNYNKSQPRHFCRACKRHWTKGGTLRNVPVGG-VRKNKRV 100
                      6899********************************************96.5777764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-223699IPR003851Zinc finger, Dof-type
PfamPF027012.2E-314598IPR003851Zinc finger, Dof-type
PROSITE profilePS5088426.74846100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGLSSKQVSS RGVDWNQTLL QDQNLELPKT LPMRKQQQQN HQLEAVNCPR CDSTNTKFCY  60
YNNYNKSQPR HFCRACKRHW TKGGTLRNVP VGGVRKNKRV KISTSISTTS KTTISTSFTT  120
TSNANRLNKK NTPSSMHESL IHPPSFLPPQ NLISTKDQSE GNNEEFGIGN GMFLSSSMPF  180
HQNQSFIFPF SNSSTLRSNN GYNYGDEEFK IMEESTINNS AMPSTSGSGT ITQPWEIPAT  240
SSGMDMSNYW SWEDIDSLVS TDLNVPWDDS DIKP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.247560.0root
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr2g013370.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF2217511e-42EF221751.1 Glycine max Dof6 transcription factor (Dof6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003593557.10.0dof zinc finger protein DOF1.4
TrEMBLG7IPR30.0G7IPR3_MEDTR; Dof domain zinc finger protein
STRINGAES638080.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-29Dof family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]