PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g108510.1
Common NameMTR_1g108510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 229aa    MW: 25743.5 Da    PI: 9.2265
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g108510.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.22.1e-231664149
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     k+ +n+sn qvtfskRr g++KKA+EL++LC+a++a+++fs++gk++ +
  Medtr1g108510.1 16 KKMSNESNLQVTFSKRRSGLFKKASELCTLCGADAALVVFSPSGKVFSF 64
                     5689******************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-34867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.315868IPR002100Transcription factor, MADS-box
CDDcd002651.53E-37977No hitNo description
SuperFamilySSF554559.29E-29984IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-201030IPR002100Transcription factor, MADS-box
PfamPF003193.7E-251864IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-203045IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-204566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MSSGKKGRGR QKIEMKKMSN ESNLQVTFSK RRSGLFKKAS ELCTLCGADA ALVVFSPSGK  60
VFSFGHPNLD TVIDRYLSLV PPQNNGTMQL IEAHRNANVR ELNAQMTQIN NTLDAEKKIG  120
DELSHFLKET EANFWWACPV DGMNKDQLEL FKKALEELKK LLIQHATTRT LPFFVGNASS  180
SNVYLHHQPN AQQAEMLPPQ FFQNPMLQLQ PHLFDGSMMP HHGFNNMV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A2e-16993186Myocyte-specific enhancer factor 2A
3kov_B2e-16993186Myocyte-specific enhancer factor 2A
3kov_I2e-16993186Myocyte-specific enhancer factor 2A
3kov_J2e-16993186Myocyte-specific enhancer factor 2A
3p57_A2e-16993186Myocyte-specific enhancer factor 2A
3p57_B2e-16993186Myocyte-specific enhancer factor 2A
3p57_C2e-16993186Myocyte-specific enhancer factor 2A
3p57_D2e-16993186Myocyte-specific enhancer factor 2A
3p57_I2e-16993186Myocyte-specific enhancer factor 2A
3p57_J2e-16993186Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447310.0AC144731.15 Medicago truncatula clone mth2-5g18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003592558.11e-172MADS-box transcription factor family protein
SwissprotQ9FKK27e-60AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLG7IAT81e-172G7IAT8_MEDTR; MADS-box transcription factor family protein
STRINGGLYMA20G27330.13e-89(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-54AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]