PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g108500.1
Common NameMTR_1g108500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family M-type_MADS
Protein Properties Length: 335aa    MW: 36733.6 Da    PI: 8.3891
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g108500.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.41.8e-18111152849
                      HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
           SRF-TF   8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 
                      n qvtfskRr g++KK +E ++LC+++va+++fs++ k++ +
  Medtr1g108500.1 111 NLQVTFSKRRSGLFKKVSEFCTLCGVDVALVVFSPSEKVFSF 152
                      679***********************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004041.1E-998118IPR002100Transcription factor, MADS-box
SMARTSM004322.2E-1899155IPR002100Transcription factor, MADS-box
PfamPF003192.1E-21111152IPR002100Transcription factor, MADS-box
CDDcd001202.58E-20111155No hitNo description
PROSITE profilePS5006617.409111156IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-18111160IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-9118133IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-9133154IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MDGKGNNSNV GGGAANNPKD NVGATTKGDT MKAPGGDGSN ISREEFEKNP QGYFADLHAA  60
QKDKELNNAF GAGDNKFKLN ATPTHYDVDK LAVRIKDEVA CKKGSFRMVA NLQVTFSKRR  120
SGLFKKVSEF CTLCGVDVAL VVFSPSEKVF SFGHPNVDTA HRSAKVCELN VELIQINNTL  180
DEEKKGSAAP SYHFGFYLSR HFSLSSSSLR FFICLSSLTK IAWTAVMWLS LKIVSDFKRT  240
LDNLSFEIIP KKNFSFKILD SAQLSFTVRD SPGFRNKTGE VLIGEFNESE VGEFTISDLD  300
SCEVRITGCI RVRSRPIVED CNGVSKSYQG IVNL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1447311e-101AC144731.15 Medicago truncatula clone mth2-5g18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003592557.10.0MADS-box transcription factor family protein, putative
TrEMBLG7IAT70.0G7IAT7_MEDTR; MADS-box transcription factor family protein, putative
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-23AGAMOUS-like 62
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]