PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g103230.1
Common NameMTR_1g103230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family CPP
Protein Properties Length: 625aa    MW: 70071.6 Da    PI: 7.1492
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g103230.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR39.31.3e-12437474340
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                      +k+C+CkkskClk+ C Cfaag++C   C+C+dC Nk 
  Medtr1g103230.1 437 CKHCKCKKSKCLKLNCGCFAAGVYCIGPCSCQDCLNKA 474
                      89**********************************96 PP

2TCR30.28.7e-10523559339
              TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                      + +C+ +ks+C +k CeCf+ g+ Cs +CkC++CkN 
  Medtr1g103230.1 523 RIQCKSRKSSCTNKRCECFKGGVGCSPSCKCQGCKNI 559
                      578*********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.1E-12435476IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.724436561IPR005172CRC domain
PfamPF036387.7E-9438473IPR005172CRC domain
SMARTSM011146.1E-8521562IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.2E-7525558IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MAALDQNNTI VSNSLEDDSF FDYLDTLSPL NTKKYVGVGA TETLNSLGMD NPLFTSLDVT  60
FNNDSIFLTR NNLLYTSNPE VSPEEAPTDS THAWIDTSQL HDPEISSDDA KYLLELLGKQ  120
EPDGTDVQDE SITDAVEGGT YNRDGPDCDY NNLISTTQSV TLLPQCTSNS NYKMKTVDPL  180
VFGSKYEIED NPSEPIAVAT DRNQAQDNLA NVALMDRNQI KRGDGELARI RRCIQRSCQG  240
YESEMTSMQR NNSDERNAIN KNPSDSQKCV LQGNGFYLNA LPALNHYEGI ENEKMPSQRK  300
PESPSCTYSL NISVRQGHQL SQVPAPMETH LRLSENEDVT KSSVHIPGED FCQSTPKRTS  360
EVQFKDIKNK KLDQNMKRTM KVHRKDPIDL VSSGSEHVKE EERADFCQSI RKRKRKPNTK  420
VQLCRNKSDL TRKGGACKHC KCKKSKCLKL NCGCFAAGVY CIGPCSCQDC LNKAINEDKV  480
LQAHRMIEYR NPPVFVPKVI TNSDSSPQIV DDSDKAPASN RRRIQCKSRK SSCTNKRCEC  540
FKGGVGCSPS CKCQGCKNIY DRKDSEAETK SELEETEASQ ISSRKDVLNH WQPEPRDRGI  600
KCYWINMKLK LNYLLLAVVA GTRH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1410415RKRKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g103230.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024630895.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A072VQY20.0A0A072VQY2_MEDTR; Tesmin/TSO1-like CXC domain protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2056123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.15e-37TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]