PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g101810.4
Common NameMTR_1g101810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family TCP
Protein Properties Length: 338aa    MW: 35418.4 Da    PI: 4.7086
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g101810.4genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP115.66.5e-3658129273
              TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                      a++k++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti WLl+qa+p+i+e+tgt++ +a ++
  Medtr1g101810.4  58 AAAKRSSKDRHTKVEGRGRRIRIPATCAARIFQLTRELGHKSDGETIRWLLEQAEPSIIEATGTGTVPAIAV 129
                      6789************************************************************77777443 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.4E-2863134IPR005333Transcription factor, TCP
PROSITE profilePS5136926.864118IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0031347Biological Processregulation of defense response
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEVNPNGGDV LCEENKTDST EVSPSETTEP AAALMKEELT ETENNSLIPV PVQTMTVAAA  60
KRSSKDRHTK VEGRGRRIRI PATCAARIFQ LTRELGHKSD GETIRWLLEQ AEPSIIEATG  120
TGTVPAIAVS VGGTLKIPTS SPARPDGEDA PVKRRRRASN SEFVDLNDQV SMCSGLAPIA  180
QTAYGAAATS SGGGSGENGG GLVPLWPVVS NGVGSNTTGP FFMFPNSTLM NQPQFWAIPA  240
APFFNVQTRP ISDFVSAMQM PQEPSNAATA YANSNASSTL APSLSSATST SCSATTSSSS  300
ATNTQMLRDF SLDIFDKKEL QFMGCSSANL ESSPSSN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00064PBMTransfer from AT5G51910Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g101810.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1558030.0AC155803.26 Medicago truncatula clone mth2-103j6, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024625426.10.0transcription factor TCP19
RefseqXP_024625433.10.0transcription factor TCP19
RefseqXP_024625442.10.0transcription factor TCP19
SwissprotQ9LT892e-76TCP19_ARATH; Transcription factor TCP19
TrEMBLA0A072VQN80.0A0A072VQN8_MEDTR; Putative transcription factor TCP family
STRINGAES625900.0(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51910.24e-71TCP family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]