PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g101280.1
Common NameMTR_1g101280
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HD-ZIP
Protein Properties Length: 754aa    MW: 82352.6 Da    PI: 5.5544
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g101280.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.67e-2157112156
                      TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  Medtr1g101280.1  57 KKRYHRHTPNQIQELESFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 112
                      678899***********************************************999 PP

2START173.31.5e-542654872205
                      HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT-TT-SEEEEEE CS
            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWdetlakaetle 83 
                      la++a++el+k+a+ ++p+W k      +++n++e+ + +++  +     + +ea r++g+v+ ++  lve+l+d ++    ++ ++a+ + l+
  Medtr1g101280.1 265 LALAAMDELLKMAQTDSPVWIKGLdgerDMLNQEEYARLISSCIGpkpagFVTEATRDTGIVIINSLALVETLMDANRyadMFQSMIARSANLD 358
                      6899*******************99999***********988777999999**************************88888888888****** PP

                      EECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
            START  84 vissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                      v+s g      ga++lm +e q+lsplvp R + ++R+++q+ +g+w++vdvSv+   +p++ ++++ +++lpSg+++++++ng+skvtw+eh+
  Medtr1g101280.1 359 VLSGGiggtrnGAIHLMHTEVQLLSPLVPvRQVRILRFCKQHAEGVWAVVDVSVEIGHDPSNAQPFISCRRLPSGCIVQDMPNGYSKVTWIEHW 452
                      ********************************************************************************************** PP

                      E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
            START 171 dlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      +++++++h+l+r+l+ sg  +ga +w atlqrqce
  Medtr1g101280.1 453 EYDESIVHQLYRPLLISGFGFGAHRWIATLQRQCE 487
                      **********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-2040114IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-2243108IPR009057Homeodomain-like
PROSITE profilePS5007117.96154114IPR001356Homeobox domain
SMARTSM003894.3E-1955118IPR001356Homeobox domain
CDDcd000866.60E-1956114No hitNo description
PfamPF000461.6E-1857112IPR001356Homeobox domain
PROSITE patternPS00027089112IPR017970Homeobox, conserved site
PROSITE profilePS5084840.089255491IPR002913START domain
SuperFamilySSF559613.94E-29256488No hitNo description
CDDcd088756.27E-111259487No hitNo description
SMARTSM002341.8E-38264488IPR002913START domain
PfamPF018528.5E-47265487IPR002913START domain
SuperFamilySSF559611.28E-22515747No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MEGQSEIGLT GDSLDTGLLG RMREDEYESR SGSDNFDLEG LSGDDQDGGD DGQRKRKKRY  60
HRHTPNQIQE LESFFKECPH PDEKQRLDLS KRLGLENKQV KFWFQNRRTQ MKTQLERHEN  120
IMLRQENDKL RGENSMMKEA MVNPICNNCG GPAIPGQILF EEHQIRIENA RLKDELNRIC  180
ALTNKFLGKP ISSLANPMAL PTSNSGLELG IGRNGFGGGS SSLGNPLPMG LDLGDGRSMP  240
GISSPMGLMG SSSDVQLERS ALIDLALAAM DELLKMAQTD SPVWIKGLDG ERDMLNQEEY  300
ARLISSCIGP KPAGFVTEAT RDTGIVIINS LALVETLMDA NRYADMFQSM IARSANLDVL  360
SGGIGGTRNG AIHLMHTEVQ LLSPLVPVRQ VRILRFCKQH AEGVWAVVDV SVEIGHDPSN  420
AQPFISCRRL PSGCIVQDMP NGYSKVTWIE HWEYDESIVH QLYRPLLISG FGFGAHRWIA  480
TLQRQCEGLA ILMSSSISND DHTALSQAGR RSMLKLAQRM TNNFCSGVCA SSARKWDSLQ  540
MGTLSDDMRV MTRKNVDDPG EPPGIVLSAA TSVWMPVSRQ RLFDFLRDER LRSEWDILSN  600
GGPMQEMVHI AKGQGQGNCV SLLRANAVNA NDSSMLILQE TWMDTSCSVV VYAPVDGQSL  660
NVVMSGGDSA YVALLPSGFA IVPDGNDPSG YGMSNGTLQK GGASDGGGSL LTVGFQILVN  720
SLPTAKLTME SVDTVNNLIS CTIQKIKAAL RVA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15357RKRKK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves and floral buds. {ECO:0000269|PubMed:10402424}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g101280.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1494940.0AC149494.4 Medicago truncatula clone mth2-116m7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024625328.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A396JYM00.0A0A396JYM0_MEDTR; Putative transcription factor & lipid binding HD-SAD family
STRINGAES625460.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]