PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g095850.1
Common NameMTR_1g095850
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family LBD
Protein Properties Length: 230aa    MW: 25125 Da    PI: 6.9132
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g095850.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.22.5e-42721711100
           DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkael 94 
                      +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++l
  Medtr1g095850.1  72 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQTQL 165
                      7********************************************************************************************* PP

           DUF260  95 allkee 100
                      a++++e
  Medtr1g095850.1 166 AKAQAE 171
                      **9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99271172IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4272169IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEHKMKTTTS PPHLPIPIHV PIHTMLSNST PSSSSSPPLQ SPTPFPSPPS QYSPPSAAPQ  60
PPSPPPPIIV SPCAACKILR RRCVEKCVLA PYFPPTDPLK FTIAHRVFGA SNIIKFLQEL  120
PEPQRADAVS SMVYEANARI RDPVYGCAGA ICQLQKQVSE LQTQLAKAQA ELVNMHCQQA  180
NLVALICMEM STQSSPDHDM IINQPQPHVD MSCFLEDNNF GSAWEPLWT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-42631792118LOB family transfactor Ramosa2.1
5ly0_B1e-42631792118LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g095850.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1444840.0AC144484.5 Medicago truncatula clone mth2-30o16, complete sequence.
GenBankAC1528180.0AC152818.17 Medicago truncatula clone mth2-85g12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591977.11e-167LOB domain-containing protein 1
SwissprotQ9LQR04e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7I9N11e-166G7I9N1_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGAES622281e-166(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-71LOB domain-containing protein 1
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]