PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g094930.1
Common NameMTR_1g094930
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family GATA
Protein Properties Length: 332aa    MW: 35978.5 Da    PI: 5.0916
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g094930.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.29.9e-18244277134
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                      C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  Medtr1g094930.1 244 CMHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 277
                      99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-682328IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.332238274IPR000679Zinc finger, GATA-type
SMARTSM004012.7E-16238288IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.109.4E-15242275IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.19E-14242301No hitNo description
CDDcd002029.86E-15243300No hitNo description
PROSITE patternPS003440244269IPR000679Zinc finger, GATA-type
PfamPF003202.2E-15244277IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MAGTMNEIDC FNLFDNIDDI YPVDDVDTAA ASLPSSAGNY NSLASIWPNE SDSVFSGNST  60
SDLSAELPVD PFEDLLSLEW VSNIVDDSFC EESLTMKVEQ QPSSSAVSKE DSGHYQFQTP  120
SPISVLESSS SCSGGKTTGI YVPIPVPCGR ARTKRPRPTA FNPRSAMQLI SPTSSSVEEN  180
MQPNVISTKA MSSDFENFAE SRIIVKKPKL SSGETKKKKK IKAPLPTAPA DSGEQIGSLP  240
VRKCMHCEIT KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF CPAVHSNSHK  300
KVLEMRCKDS FESDSAELIP NTNVLALEYN I*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1153157KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.82670.0flower| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2023680.0AC202368.9 Medicago truncatula clone mth2-73h18, complete sequence.
GenBankAC1487570.0AC148757.4 Medicago truncatula clone mth2-57e16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591890.10.0GATA type zinc finger transcription factor family protein
TrEMBLG7I3780.0G7I378_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA10G35470.21e-136(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-43GATA family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]