PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr1g093080.1
Common NameMTR_1g093080
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family G2-like
Protein Properties Length: 379aa    MW: 42166.7 Da    PI: 7.9606
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr1g093080.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.3e-32211266156
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                      k+r++W++eLH+rF++a++qLGG++ AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  Medtr1g093080.1 211 KQRRCWSQELHKRFLKALQQLGGADCATPKQIREVMNVDGLTNDEVKSHLQKYRLH 266
                      79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.221208268IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-28209269IPR009057Homeodomain-like
SuperFamilySSF466896.27E-18209269IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-27211266IPR006447Myb domain, plants
PfamPF002499.2E-8213264IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0055062Biological Processphosphate ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MQRFKMGFSD YIQALEQERR KIQVFPKELP LSLELVTQAI EACRQQLSGT TTEYNLNGQS  60
ECSEQTTSTD GPVLEEFIPI KKRASSYSQE VFDDVEDYDQ HFHHKQQKLS LDNKKKSDWL  120
RSVQLWNSDP SSEEDVTKKA VPVLELKRNG CGGGAFHPFH KEDRVNNTTS ELLSKGQPSS  180
TGVAAVSSNA ATVTSNNVEN RKRDEKEEKR KQRRCWSQEL HKRFLKALQQ LGGADCATPK  240
QIREVMNVDG LTNDEVKSHL QKYRLHTRRP SSTNNESANS QTAAPFVLVG NIFVQQQEYG  300
GVASSTTTGE MTKVVAPSGI YAPVATHPQV ATIKKPEFKK FEHSISEERG NNSEGAVHSN  360
SPTSSSSTHT TTNASTGY*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.24980.0glandular trichome| root| stem
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate homeostasis. Involved in the regulation of the developmental response of lateral roots, acquisition and/or mobilization of phosphate and expression of a subset of genes involved in phosphate sensing and signaling pathway. Is a target of the transcription factor PHR1. {ECO:0000269|PubMed:27016098}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00218DAPTransfer from AT1G68670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr1g093080.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced under phosphate deprivation conditions. {ECO:0000269|PubMed:27016098}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1400270.0AC140027.11 Medicago truncatula clone mth2-5m21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591795.20.0transcription factor HHO2
SwissprotQ8VZS39e-79HHO2_ARATH; Transcription factor HHO2
TrEMBLG7I4650.0G7I465_MEDTR; Myb-like transcription factor family protein
STRINGAES620460.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF39183363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68670.11e-72G2-like family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  2. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]
  3. Sun X, et al.
    The GARP/MYB-related grape transcription factor AQUILO improves cold tolerance and promotes the accumulation of raffinose family oligosaccharides.
    J. Exp. Bot., 2018. 69(7): p. 1749-1764
    [PMID:29385617]